Product Information
60447-1-PBS targets CHCHD1 as part of a matched antibody pair:
MP50603-1: 60447-1-PBS capture and 60447-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2325 Product name: Recombinant human CHCHD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC020852 Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS Predict reactive species |
Full Name | coiled-coil-helix-coiled-coil-helix domain containing 1 |
Calculated Molecular Weight | 13 kDa |
GenBank Accession Number | BC020852 |
Gene Symbol | CHCHD1 |
Gene ID (NCBI) | 118487 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q96BP2 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |