Use Able AI chat for product recommendations

Chromogranin A Monoclonal antibody

Chromogranin A Monoclonal Antibody for WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA

Cat No. 60135-2-Ig
Clone No.2A7D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA

CGA, CHGA, 2A7D11, AL-11, Chromogranin-A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat adrenal gland tissue, SH-SY5Y cells
Positive IHC-Autostainer detected inhuman colorectal cancer tissue, human stomach cancer tissue, human pituitary adenoma tissue, human appendicitis tissue
Positive IHC detected inhuman pancreas cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman pancreas cancer tissue
Positive IF/ICC detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:3000-1:12000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60135-2-Ig targets Chromogranin A in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0807

Product name: Recombinant human CHGA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-457 aa of BC006459

Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Predict reactive species
Full Name chromogranin A (parathyroid secretory protein 1)
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC006459
Gene Symbol Chromogranin A
Gene ID (NCBI) 1113
RRIDAB_2918358
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10645
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.

Protocols

Product Specific Protocols
IF protocol for Chromogranin A antibody 60135-2-IgDownload protocol
IHC protocol for Chromogranin A antibody 60135-2-IgDownload protocol
WB protocol for Chromogranin A antibody 60135-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer

Authors - Rong Wang
humanIHC

Cancer Lett

SNHG18 deficiency reprograms arginine metabolism to foster an immunosuppressive microenvironment in prostate cancer bone metastasis.

Authors - Zhong Xie
humanWB

Cell Death Discov

SMARCA4 promotes lineage plasticity and enzalutamide resistance in prostate cancer by regulating PROX1 via H3K27 acetylation.

Authors - Chenwei Wu
mouseIF

Stem Cell Res Ther

Expansion of mouse castration-resistant intermediate prostate stem cells in vitro

Authors - Yalan Xu
mouseIF

J Agric Food Chem

Mechanism of Acylated Starch on Barrier Function of Intestinal Organoids Based on Microbiomics and Metabolomics.

Authors - Han Li
humanWB

Mol Cell Proteomics

Quantitative Proteomics of Tissue-Infiltrating T Cells From CRC Patients Identified Lipocalin-2 Induces T-Cell Apoptosis and Promotes Tumor Cell Proliferation by Iron Efflux.

Authors - Rui Che
Loading...
||
New chat

Able™

正在加载,请稍候...