CITED2 Polyclonal antibody

CITED2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 15021-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

MSG-related protein 1, MSG related protein 1, MRG-1, MRG1, MRG 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, mouse brain tissue
Positive IHC detected inmouse brain tissue, mouse ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

15021-1-AP targets CITED2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7078

Product name: Recombinant human CITED2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-270 aa of BC004377

Sequence: MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC

Predict reactive species
Full Name Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 36 kDa, 27 kDa
GenBank Accession NumberBC004377
Gene Symbol CITED2
Gene ID (NCBI) 10370
RRIDAB_2080545
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99967
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CITED2, also named as P35srj, is a cAMP-responsive element-binding protein (CBP)/p300-transactivator, with an ED(Glu/Asp)-rich C-terminal domain that acts as an important modulator in the development of the heart [PMID:10552932]. There are two isoforms of CITED2 protein and the calculated molecular weight of them are 24kDa and 28 kDa. The 28 kDa isoform having modification site may migrate to 35 kDa and 24 kDa isoform having modification site may migrate to 27 kDa (PMID: 23082118). It is proposed to be a negative regulator of HIF-1α through its competitive binding to the CH1 domain of CBP/p300, which mediated signaling and to a decrease in HIF-1-responsive genes such as VEGF [PMID:9887100]. In addition, it is also a co-activator of the transcriptional activity of the TFAP2 isoform, which is an extensively expressed nuclear protein with functions in embryogenesis, inflammation, and stress responses[PMID:22735262].

Protocols

Product Specific Protocols
WB protocol for CITED2 antibody 15021-1-APDownload protocol
IHC protocol for CITED2 antibody 15021-1-APDownload protocol
IF protocol for CITED2 antibody 15021-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Toxicol Sci

The role of miR-182-5p in hepatocarcinogenesis of trichloroethylene in mice.

Authors - Yan Jiang
Loading...
||
New chat Able
正在加载,请稍候...