Tested Applications
| Positive WB detected in | human placenta tissue, rat heart tissue, K-562 cells, mouse heart tissue |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | mouse heart tissue, human kidney tissue, human testis tissue, human liver tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15698-1-AP targets CLPP in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken, zebrafish, goat, c.elegans |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8325 Product name: Recombinant human CLPP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC002956 Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST Predict reactive species |
| Full Name | ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 26 kDa, 30 kDa |
| GenBank Accession Number | BC002956 |
| Gene Symbol | CLPP |
| Gene ID (NCBI) | 8192 |
| RRID | AB_2245115 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16740 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. This protein has a transit peptide of 56 amino acid.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLPP antibody 15698-1-AP | Download protocol |
| IHC protocol for CLPP antibody 15698-1-AP | Download protocol |
| IP protocol for CLPP antibody 15698-1-AP | Download protocol |
| WB protocol for CLPP antibody 15698-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CLPP Polyclonal antibody (Cat# 15698-1-AP) has accumulated 71 citations across journals including Nature Communications, Cell Metabolism, Nature Metabolism, Molecular Cell, Journal of Biological Chemistry, Autophagy, Science Advances, and Human Molecular Genetics. Associated research fields encompass mitochondrial proteostasis, the mitochondrial unfolded protein response (UPRmt), mitophagy, mitochondrial dynamics, neurodegeneration, cancer biology, metabolic disorders, immunology, and aging.
| Species | Application | Title |
|---|---|---|
Cell Metab Proteolytic cleavage of opa1 stimulates mitochondrial inner membrane fusion and couples fusion to oxidative phosphorylation. | ||
Cell Metab Fibroblast Growth Factor 21 Drives Dynamics of Local and Systemic Stress Responses in Mitochondrial Myopathy with mtDNA Deletions. | ||
Cell Metab mTORC1 Regulates Mitochondrial Integrated Stress Response and Mitochondrial Myopathy Progression. | ||
Nat Metab LONP1 regulation of mitochondrial protein folding provides insight into beta cell failure in type 2 diabetes | ||
Autophagy Mitochondrial dynamics and quality control regulate proteostasis in neuronal ischemia-reperfusion | ||
Nat Commun Mic19 depletion impairs endoplasmic reticulum-mitochondrial contacts and mitochondrial lipid metabolism and triggers liver disease |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating. For Western blot, users report clear, single bands at a 1:1000–1:2000 dilution across cell types including heart cells, HeLa, and HCt116. One reviewer also used it for immunofluorescence at 1:200, noting a clean signal that specifically highlighted the mitochondrial matrix. Overall, the antibody is described as excellent, producing sharp and specific results in both WB and IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anh (Verified Customer) (07-15-2021) | very good, very clear bands
|
Mariusz (Verified Customer) (02-06-2019) | Excellent antibody bot for Western blot (1:2000) dilution and immunofluorescence (1:200). Single band on Western, and clean signal reflecting mitochondrial matrix in IF.
|
