Product Information
83931-1-PBS targets CLSTN3 in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14897 Product name: Recombinant human CLSTN3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 206-289 aa of BC039075 Sequence: VLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPMEVRGLGKRGSVGSRLWSTHVLPESAVLCDGGCWGPAGG Predict reactive species |
| Full Name | calsyntenin 3 |
| Calculated Molecular Weight | 968 aa, 107 kDa |
| GenBank Accession Number | BC039075 |
| Gene Symbol | CLSTN3 |
| Gene ID (NCBI) | 9746 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9BQT9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Calsyntenins, also called alcadeins, are cadherin superfamily proteins first identified as synaptic proteins (PMID: 11161476; 12498782). Calsyntenins are type I transmembrane proteins with extracellular domains containing two cadherin repeats and an LNS (laminin, neurexin, sex hormone-binding globulin) domain (PMID: 24613359). Calsyntenin-3 (CLSTN3, also known as alcadein-beta) is a synapse-organizing protein that promotes the development of synapses. It is a postsynaptic adhesion molecule that binds to presynaptic neurexins to mediate both excitatory and inhibitory synapse formation (PMID: 25352602; 24613359).
