Tested Applications
| Positive WB detected in | rat skin tissue, pig skin tissue, mouse tail tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66761-1-Ig targets Collagen Type I in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, rabbit, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6281 Product name: Recombinant human COL1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1017-1366 aa of BC054498 Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK Predict reactive species |
| Full Name | collagen, type I, alpha 2 |
| Calculated Molecular Weight | 1366 aa, 130 kDa |
| Observed Molecular Weight | 140 kDa, 70-80 kDa |
| GenBank Accession Number | BC054498 |
| Gene Symbol | COL1A2 |
| Gene ID (NCBI) | 1278 |
| RRID | AB_2882107 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P08123 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. When MMPs degrade type I collagen, the major degradation products are the typical ¾ and ¼ collagen fragments with molecular weights of ~ 50-70 kDa, and ~ 25 (PMID: 8910479).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Collagen Type I antibody 66761-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Collagen Type I Monoclonal antibody (3D5E8), catalog number 66761-1-Ig, has accumulated 312 citations. These appear in high-impact journals including Nature Communications, Advanced Materials, Advanced Science, Biomaterials, Acta Biomaterialia, Journal of Controlled Release, Phytomedicine, and International Immunopharmacology, among others. Research fields encompass fibrosis (pulmonary, cardiac, hepatic, renal), bone regeneration, wound healing, tissue engineering, ferroptosis, and oncology.
| Species | Application | Title |
|---|---|---|
Adv Mater Reprogramming the Immunosuppressive Microenvironment in Triple-Negative Breast Cancer via FAP-Targeted Nanoprobes for Multimodal Imaging and Photothermal Therapy. | ||
Adv Mater Biodegradable Self-Enhancing Piezoelectric Scaffold for Synchronized Tendon-to-Bone Regeneration. | ||
Light Sci Appl Dual-step photo-induced self-assembled hydrogel for endogenous oral mucosal wound healing | ||
Cell Mol Immunol Blocking the m6Am methyltransferase PCIF1 in macrophages attenuates colitis progression by preventing neuronal damage | ||
Bioact Mater 3D-printed tri-element-doped hydroxyapatite/ polycaprolactone composite scaffolds with antibacterial potential for osteosarcoma therapy and bone regeneration | ||
Bioact Mater Biodegradable Mg(2+)-releasing piezoelectric scaffold for segmental bone defect repair. |
Reviews
What customers say
The single user review for 66761-1-Ig is from Su Wu (March 2022), who rated the product 5 out of 5 stars. They used it at a 1:250 dilution on cancer tissue for immunohistochemistry and commented that it "works good and consistent." Overall, the feedback is positive, highlighting reliable performance and consistency in IHC applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Su (Verified Customer) (03-18-2022) | Works good and consistent.
 |
