Collagen Type I Monoclonal antibody, PBS Only

• 

  WB analysis of rat skin using 66761-1-Ig (same clone as 66761-1-PBS)

  rat skin tissue were subjected to SDS PAGE followed by western blot with 66761-1-Ig (Collagen Type I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66761-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Mouse tail using 66761-1-Ig (same clone as 66761-1-PBS)

  Mouse tail tissue were subjected to SDS PAGE followed by western blot with 66761-1-Ig (Collagen Type I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66761-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig skin using 66761-1-Ig (same clone as 66761-1-PBS)

  pig skin tissue were subjected to SDS PAGE followed by western blot with 66761-1-Ig (Collagen Type I antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66761-1-PBS in a different storage buffer formulation.

Collagen Type I Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66761-1-PBS

Clone No.3D5E8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

COL1, COL1A2, 3D5E8, Alpha-2 type I collagen, col I

---

Product Information

66761-1-PBS targets Collagen Type I in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6281

  Product name: Recombinant human COL1A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1017-1366 aa of BC054498

  Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

• Full Name: collagen, type I, alpha 2
• Calculated Molecular Weight: 1366 aa, 130 kDa
• Observed Molecular Weight: 140 kDa, 70-80 kDa
• GenBank Accession Number: BC054498
• Gene Symbol: COL1A2
• Gene ID (NCBI): 1278
• RRID: AB_2882107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08123
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. When MMPs degrade type I collagen, the major degradation products are the typical ¾ and ¼ collagen fragments with molecular weights of ~ 50-70 kDa, and ~ 25 (PMID: 8910479).