Use Able AI chat for product recommendations

Collagen Type I Monoclonal antibody, PBS Only

Collagen Type I Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66761-1-PBS
Clone No. 3D5E8
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

COL1, COL1A2, 3D5E8, Alpha-2 type I collagen, col I

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Collagen Type I in ?

Product Information

66761-1-PBS targets Collagen Type I in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityrat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6281

Product name: Recombinant human COL1A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1017-1366 aa of BC054498

Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predict reactive species
Full Name collagen, type I, alpha 2
Calculated Molecular Weight 1366 aa, 130 kDa
Observed Molecular Weight 140 kDa, 70-80 kDa
GenBank Accession NumberBC054498
Gene Symbol COL1A2
Gene ID (NCBI) 1278
RRIDAB_2882107
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08123
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. When MMPs degrade type I collagen, the major degradation products are the typical ¾ and ¼ collagen fragments with molecular weights of ~ 50-70 kDa, and ~ 25 (PMID: 8910479).

Publications

What published studies show

Collagen Type I Monoclonal Antibody (3D5E8), Cat# 66761-1-PBS, has 312 citations published in journals including Nature Communications, Advanced Materials, Cell Stem Cell, Advanced Science, Biomaterials, Journal of Clinical Investigation, Phytomedicine, International Immunopharmacology, and Scientific Reports. Associated research fields span fibrosis (pulmonary, hepatic, cardiac, renal), bone regeneration, wound healing, tendon repair, ferroptosis, cardiovascular disease, diabetic complications, cancer, stem cell therapy, and nanomedicine/biomaterials.

SpeciesApplicationTitle
ratWB

Adv Sci (Weinh)

Chronic Psychological Stress Induces Cardiomyocyte Hypertrophy Through Corticosterone-Glucocorticoid Receptor-LAMA5 Axis

Authors - Chuanjing Zhang
Loading...
||
New chat

Able™

正在加载,请稍候...