Collagen Type I Monoclonal antibody, PBS Only

Collagen Type I Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66761-1-PBS
Clone No.3D5E8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

COL1, COL1A2, 3D5E8, Alpha-2 type I collagen, col I

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

WBSee 1 publications below

Product Information

66761-1-PBS targets Collagen Type I in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityrat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6281

Product name: Recombinant human COL1A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1017-1366 aa of BC054498

Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predict reactive species
Full Name collagen, type I, alpha 2
Calculated Molecular Weight 1366 aa, 130 kDa
Observed Molecular Weight 140 kDa, 70-80 kDa
GenBank Accession NumberBC054498
Gene Symbol COL1A2
Gene ID (NCBI) 1278
RRIDAB_2882107
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08123
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. When MMPs degrade type I collagen, the major degradation products are the typical ¾ and ¼ collagen fragments with molecular weights of ~ 50-70 kDa, and ~ 25 (PMID: 8910479).

Publications

SpeciesApplicationTitle
ratWB

Adv Sci (Weinh)

Chronic Psychological Stress Induces Cardiomyocyte Hypertrophy Through Corticosterone-Glucocorticoid Receptor-LAMA5 Axis

Authors - Chuanjing Zhang
Loading...
||
New chat Able
正在加载,请稍候...