COQ9 Polyclonal antibody

• 

  WB analysis using 14874-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14874-1-AP (COQ9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 14874-1-AP

  WB result of COQ9 antibody (14874-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COQ9 transfected HEK-293 cells.

• 

  IP experiment of HeLa using 14874-1-AP

  IP result of anti-COQ9 (IP:14874-1-AP, 3ug; Detection:14874-1-AP 1:500) with HeLa cells lysate 1840ug.

• 

  IHC staining of human liver cancer using 14874-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14874-1-AP (COQ9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14874-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14874-1-AP (COQ9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 14874-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using COQ9 antibody (14874-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

COQ9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14874-1-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

C16orf49, HSPC326, PSEC0129, Ubiquinone biosynthesis protein COQ9, mitochondrial

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IF: See 2 publications below

Product Information

14874-1-AP targets COQ9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6645

  Product name: Recombinant human COQ9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-318 aa of BC064946

  Sequence: MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR

• Full Name: coenzyme Q9 homolog (S. cerevisiae)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC064946
• Gene Symbol: COQ9
• Gene ID (NCBI): 57017
• RRID: AB_2082218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75208
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COQ9, also named as C16orf49, HSPC326, and PSEC0129, is a 318 amino acid protein, which belongs to the COQ9 family. COQ9 localizes in the Mitochondrion and is involved in the biosynthesis of coenzyme Q COQ9 has abilities to improve left ventricular performance and to reduce myocardial infarct size and cardiomyocyte apoptosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF	J Clin Invest; COQ6 mutations in human patients produce nephrotic syndrome with sensorineural deafness.; Authors - Heeringa Saskia F SF
human	WB	J Am Soc Nephrol; ADCK4 Deficiency Destabilizes the Coenzyme Q Complex, Which Is Rescued by 2,4-Dihydroxybenzoic Acid Treatment.; Authors - Eugen Widmeier
human	WB	J Med Genet; Human COQ4 deficiency: delineating the clinical, metabolic and neuroimaging phenotypes.; Authors - Lucia Laugwitz
human	WB	Front Physiol; Human COQ9 Rescues a coq9 Yeast Mutant by Enhancing Coenzyme Q Biosynthesis from 4-Hydroxybenzoic Acid and Stabilizing the CoQ-Synthome.; Authors - Cuiwen H He
human	WB	Mol Genet Metab; Detection of 6-demethoxyubiquinone in CoQ10 deficiency disorders: Insights into enzyme interactions and identification of potential therapeutics.; Authors - Diran Herebian ; KD Validated
human	IF	J Cell Biol; Coenzyme Q biosynthetic proteins assemble in a substrate-dependent manner into domains at ER-mitochondria contacts.; Authors - Kelly Subramanian

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ying (Verified Customer) (03-31-2021)

This antibody works well for our westerns of cultured mouse cell extracts.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: mouse macrophage