Tested Applications
| Positive WB detected in | HepG2 cells, A549 cells, MCF-7 cells, mouse liver tissue, mouse spleen tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 20 publications below |
| WB | See 396 publications below |
| IHC | See 40 publications below |
| IF | See 33 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
| ChIP | See 1 publications below |
Product Information
15184-1-AP targets CPT1A in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, bovine, goat, yellow croaker, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7202 Product name: Recombinant human CPT1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 406-756 aa of BC000185 Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT Predict reactive species |
| Full Name | carnitine palmitoyltransferase 1A (liver) |
| Calculated Molecular Weight | 88 kDa |
| Observed Molecular Weight | 86 kDa |
| GenBank Accession Number | BC000185 |
| Gene Symbol | CPT1A |
| Gene ID (NCBI) | 1374 |
| RRID | AB_2084676 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50416 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CPT1A, also named CPT1, CPT1-L and L-CPTI, belongs to the carnitine/choline acetyltransferase family. CPT1A gene is localized Chromosome 11q13.1-2. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active form of related liver-type carnitine palmitoyltransferase I (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CPT1A antibody 15184-1-AP | Download protocol |
| IF protocol for CPT1A antibody 15184-1-AP | Download protocol |
| IHC protocol for CPT1A antibody 15184-1-AP | Download protocol |
| IP protocol for CPT1A antibody 15184-1-AP | Download protocol |
| WB protocol for CPT1A antibody 15184-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Hypoxia induces mitochondrial protein lactylation to limit oxidative phosphorylation | ||
Cell Metab Quiescent Endothelial Cells Upregulate Fatty Acid β-Oxidation for Vasculoprotection via Redox Homeostasis. | ||
Cell Metab Targeting Erbin-mitochondria axis in platelets/megakaryocytes promotes B cell-mediated antitumor immunity | ||
Cell Metab SGLT2 Inhibition Mediates Protection from Diabetic Kidney Disease by Promoting Ketone Body-Induced mTORC1 Inhibition. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH YINGJIAN (Verified Customer) (08-07-2025) | It yields a clear signal with minimal background in both Western blot and immunohistochemistry assays
![]() |
FH Yuan (Verified Customer) (09-12-2024) | We suffered from poor images with CPT1 antibodies purchased from other companies. This antibody saved us. The top band is CPT1A at 80 kDa and the bottom one is GAPDH in the attached graph.
![]() |
FH Tom (Verified Customer) (05-17-2021) | Antibody used at 1/1000 for 24 hours at 4 degrees. Non-specific bands were also present upon imaging.
![]() |
FH Linlin (Verified Customer) (05-08-2019) | This CPT1A antibody is ideal for precipitation of CPT1A in cell lysates and immunoblot analysis of CPT1A. Recommend.
![]() |























