Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, HepG2 cells, MCF-7 cells, mouse liver tissue, rat liver tissue, mouse spleen tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15184-1-AP targets CPT1A in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, goat, yellow croaker, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7202 Product name: Recombinant human CPT1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 406-756 aa of BC000185 Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT Predict reactive species |
| Full Name | carnitine palmitoyltransferase 1A (liver) |
| Calculated Molecular Weight | 88 kDa |
| Observed Molecular Weight | 86 kDa |
| GenBank Accession Number | BC000185 |
| Gene Symbol | CPT1A |
| Gene ID (NCBI) | 1374 |
| RRID | AB_2084676 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50416 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CPT1A, also named CPT1, CPT1-L and L-CPTI, belongs to the carnitine/choline acetyltransferase family. CPT1A gene is localized Chromosome 11q13.1-2. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active form of related liver-type carnitine palmitoyltransferase I (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CPT1A antibody 15184-1-AP | Download protocol |
| IF protocol for CPT1A antibody 15184-1-AP | Download protocol |
| IHC protocol for CPT1A antibody 15184-1-AP | Download protocol |
| IP protocol for CPT1A antibody 15184-1-AP | Download protocol |
| WB protocol for CPT1A antibody 15184-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CPT1A Polyclonal antibody (catalog number 15184-1-AP) has a total of 605 citations. These appear across high-impact journals including Nature, Cell, Cell Metabolism, Nature Communications, Cell Reports, Signal Transduction and Targeted Therapy, Cancer Cell, Immunity, Nature Genetics, and numerous others such as Cell Death & Disease, Redox Biology, and Phytomedicine. Research fields span lipid/fatty acid metabolism, mitochondrial function, cancer (liver, colorectal, lung, breast), metabolic diseases (NAFLD/NASH, diabetes, obesity), immunology, and ferroptosis.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting carnitine palmitoyl transferase 1A (CPT1A) induces ferroptosis and synergizes with immunotherapy in lung cancer | ||
Signal Transduct Target Ther FGF1ΔHBS prevents diabetic cardiomyopathy by maintaining mitochondrial homeostasis and reducing oxidative stress via AMPK/Nur77 suppression. | ||
Cancer Cell Multiomic integration reveals tumoral heterogeneity of lipid dependence within lethal group 3 medulloblastoma. | ||
Cell Intermittent fasting triggers interorgan communication to suppress hair follicle regeneration | ||
Reviews
What customers say
Customers rate this CPT1A antibody highly (average ~4.8/5). Most praise its strong, clear signal with minimal background in Western blot and IHC, noting it outperforms alternatives from other vendors. It works well across human cancer cells, fibroblasts, and HEK293 at dilutions ranging from 1:500 to 1:5000. One user reported some non-specific bands at 1:1000 overnight. It is also recommended for immunoprecipitation of CPT1A from cell lysates. Overall, reviewers find it reliable and specific for CPT1A detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jianhua (Verified Customer) (10-04-2026) | Works very well for CPT1A western blot in human cancer cells
|
YINGJIAN (Verified Customer) (08-07-2025) | It yields a clear signal with minimal background in both Western blot and immunohistochemistry assays
 |
Yuan (Verified Customer) (09-12-2024) | We suffered from poor images with CPT1 antibodies purchased from other companies. This antibody saved us. The top band is CPT1A at 80 kDa and the bottom one is GAPDH in the attached graph.
 |
Tom (Verified Customer) (05-17-2021) | Antibody used at 1/1000 for 24 hours at 4 degrees. Non-specific bands were also present upon imaging.
 |
Linlin (Verified Customer) (05-08-2019) | This CPT1A antibody is ideal for precipitation of CPT1A in cell lysates and immunoblot analysis of CPT1A. Recommend.
 |
