Use Able AI chat for product recommendations

CRH/CRF Polyclonal antibody

CRH/CRF Polyclonal Antibody for WB, IF-P, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

CRH, Corticoliberin, Corticotropin releasing factor, Corticotropin-releasing factor, Corticotropin-releasing hormone

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CRH/CRF in ?

Tested Applications

Positive WB detected inrat brain tissue, mouse brain tissue
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26848-1-AP targets CRH/CRF in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25226

Product name: Recombinant human CRH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-156 aa of BC011031

Sequence: SEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEE

Predict reactive species
Full Name CRH/CRF
Calculated Molecular Weight 21 kDa
Observed Molecular Weight27 kDa
GenBank Accession NumberBC011031
Gene Symbol CRH
Gene ID (NCBI) 1392
RRIDAB_3085911
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06850
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRH, also called CRF or corticoliberin, is a peptide hormone and neurotransmitter involved in the stress response. Marked reduction in this protein has been observed in association with Alzheimer disease. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery.

Protocols

Product Specific Protocols
IF protocol for CRH/CRF antibody 26848-1-APDownload protocol
IHC protocol for CRH/CRF antibody 26848-1-APDownload protocol
WB protocol for CRH/CRF antibody 26848-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CRH/CRF Polyclonal antibody (Cat# 26848-1-AP) has 8 total citations published in journals including Cell, Nature Communications, Food Research International, International Journal of Biological Macromolecules, International Journal of Molecular Sciences, Digestive Diseases and Sciences, Current Medical Science, and Neuropharmacology. The research fields span stress response and HPA axis regulation, brain-gut axis disorders, metabolic dysfunction, neuropharmacology, anxiety/depression, bone loss, and sepsis, with applications in mouse, human, and rat models.

SpeciesApplicationTitle
mouse

Cell

A skin-hypothalamus axis couples heat stress and metabolic dysfunction.

Authors - Hai-Yan Zhou
mouse,human

Nat Commun

Cortical arealization of interneurons defines shared and distinct molecular programs in developing human and macaque brains

Authors - Xiangling Feng
ratWB

Food Res Int

Lactobacillus reuteri or Lactobacillus rhamnosus GG intervention facilitates gut barrier function, decreases corticosterone and ameliorates social behavior in LPS-exposed offspring

Authors - Xinyuan Wang

Int J Biol Macromol

An injectable responsive exosome-releasing hydrogel based on sodium alginate restores motor and bladder function by alleviating the injury microenvironment and facilitating distal nerve repair

Authors - Yabin Lin
ratWB

Int J Mol Sci

Chronic Stress Leads to Time-Dependent Bone Loss Through HPA Axis Dysregulation and GR Nuclear Translocation Disorder.

Authors - Yupeng Yan

Dig Dis Sci

Saikosaponin D Improves Diarrhea-Predominant Irritable Bowel Syndrome by Regulating the Brain-Gut Axis: Based on Changes in the Gut HMGB1-TLR4/NF-κB Pathway and Hypothalamic HPA Axis.

Authors - Guilin Dong
Loading...
||
New chat

Able™

正在加载,请稍候...