Recombinant human CRYGC protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag12611
Synonyms
CCL; CRYG3
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
(1-174 aa encoded by BC074955) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
