CSNK2A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CSNK2A2 Polyclonal antibody (10606-1-AP)

CSNK2A2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 10606-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CSNK2A 2, EC:2.7.11.1

• 

  WB analysis using 10606-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10606-1-AP (CSNK2A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 10606-1-AP

  IP result of anti-CSNK2A2 (IP:10606-1-AP, 4ug; Detection:10606-1-AP 1:8000) with Jurkat cells lysate 1400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10606-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CSNK2A2 antibody (10606-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CSNK2A2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10606-1-AP targets CSNK2A2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0877

  Product name: Recombinant human CSNK2A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-350 aa of BC008812

  Sequence: KYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

• Full Name: casein kinase 2, alpha prime polypeptide
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC008812
• Gene Symbol: CSNK2A2
• Gene ID (NCBI): 1459
• RRID: AB_2292447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19784
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSNK2A2(Casein kinase II subunit alpha') is also named as CK2A3, CK2A2, CSNK2A1, CK2 and belongs to the protein kinase superfamily. It can function as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage during mitosis. It also can protect against ionizing radiation-induced apoptosis partly by phosphorylating and activating SIRT1. This protein has molecular weights between 35 kDa and 44 kDa(PMID:8622692).

Publications

What published studies show

The CSNK2A2 (CK2α') Polyclonal antibody (Cat# 10606-1-AP) has 7 citations published in Nature Communications, Cell Genomics, Cell Reports, Acta Neuropathologica Communications, International Immunopharmacology, Biochemical and Biophysical Research Communications, and bioRxiv. Research fields span neuroinflammation and neurodegeneration, hepatocellular carcinoma, Huntington's disease, ischemic stroke, and embryonic stem cell biology. Applications cited include WB, IHC, IF, and IP in human and mouse samples.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	Nat Commun; CK2 inhibition suppresses glial inflammation in models of neuroinflammation and neurodegeneration.; Authors - Ioana I. N. Da Silva
human	WB,IP	Cell Genom; NRDE2 deficiency impairs homologous recombination repair and sensitizes hepatocellular carcinoma to PARP inhibitors; Authors - Yahui Wang ; KD Validated
mouse	WB	Cell Rep; Tumor suppressor p53 regulates heat shock factor 1 protein degradation in Huntington's disease; Authors - Rachel H Mansky ; KD Validated
mouse	WB,IHC	Acta Neuropathol Commun; CK2 alpha prime and alpha-synuclein pathogenic functional interaction mediates synaptic dysregulation in huntington's disease.; Authors - Dahyun Yu
human	WB	Int Immunopharmacol; A quinolinyl resveratrol derivative alleviates acute ischemic stroke injury by promoting mitophagy for neuroprotection via targeting CK2α'; Authors - Libin Xu
mouse	WB	Biochem Biophys Res Commun; β-catenin stimulates Tcf7l1 degradation through recruitment of casein kinase 2 in mouse embryonic stem cells.; Authors - Yan Zhang