CoraLite® Plus 488-conjugated CSNK2A2 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-10606

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 CSNK2A2 antibody (CL488-10606) at dilution of 1:200.

CSNK2A2 Polyclonal Antibody for IF/ICC

Cat No. CL488-10606

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CSNK2A2, EC:2.7.11.1, CSNK2A 2, CSNK2A1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10606 targets CSNK2A2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0877

  Product name: Recombinant human CSNK2A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-350 aa of BC008812

  Sequence: KYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

• Full Name: casein kinase 2, alpha prime polypeptide
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC008812
• Gene Symbol: CSNK2A2
• Gene ID (NCBI): 1459
• RRID: AB_3672453
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19784
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CSNK2A2(Casein kinase II subunit alpha') is also named as CK2A3, CK2A2, CSNK2A1, CK2 and belongs to the protein kinase superfamily. It can function as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage during mitosis. It also can protect against ionizing radiation-induced apoptosis partly by phosphorylating and activating SIRT1. This protein has molecular weights between 35 kDa and 44 kDa(PMID:8622692).