Recombinant human CTGF protein
Source
e coli.-derived, PET30a
Tag
6*His
Format
Liquid
Cat no : Ag21008
Synonyms
CTGF, CCN family member 2, CCN2, Cellular communication network factor 2, HCS24
Validation Data Gallery View All
Product Information
| Peptide Sequence |
RTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
(297-349 aa encoded by BC087839) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
