CXCL16 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CXCL16 Monoclonal antibody (60123-1-Ig)

• Featured Product
• KD/KO Validated

CXCL16 Monoclonal Antibody for WB, ELISA

Cat No. 60123-1-Ig Copied!

Clone No. 2H7B3

Publications (14)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (2)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

2H7B3, C X C motif chemokine 16, C-X-C motif chemokine 16, CXCL 16, Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein

• 

  WB analysis of SH-SY5Y using 60123-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 60123-1-Ig (CXCL16 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 60123-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60123-1-Ig (CXCL16 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CXCL16 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HaCaT cells, SH-SY5Y cells, Calu-3 cells, A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60123-1-Ig targets CXCL16 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4883

  Product name: Recombinant human CXCL16 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 46-225 aa of BC017588

  Sequence: GNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATV

• Full Name: chemokine (C-X-C motif) ligand 16
• Calculated Molecular Weight: 273 aa, 30 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC017588
• Gene Symbol: CXCL16
• Gene ID (NCBI): 58191
• RRID: AB_2086188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H2A7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL16 is a recently discovered cytokine belonging to the CXC chemokine family, which is synthesised in plasmacytoid dendritic cell as a transmembrane molecule. It exists in a transmembrane and soluble form. The transmembrane form of CXCL16 functions as an adhesion molecule for CXCR6-expressing cells, whereas the soluble form of CXCL16 mediates infiltration of circulating cells into sites of injury. CXCL16, has been proposed as an important pathogenic mediator in inflammatory diseases, including rheumatoid arthritis, glomerulonephritis, or prostate cancer. CXCL16 has been implicated in some forms of renal disease such as lupus nephritis and antiglomerular basement membrane nephritis. CXCL16 also plays a pivotal role in the pathogenesis of angiotensin II-induced renal injury and fibrosis through regulation of macrophage and T cell infiltration and bone marrow-derived fibroblast accumulation.

Publications

What published studies show

The CXCL16 Monoclonal antibody (Cat# 60123-1-Ig) has 14 citations across journals including Neuron, Experimental Molecular Medicine, Journal for ImmunoTherapy of Cancer, Cardiovascular Diabetology, British Journal of Pharmacology, FASEB Journal, Cancer Communications, Hepatology Communications, Inflammation, Molecular Medicine Reports, and others. Research fields span hepatocellular carcinoma, prostate cancer, liver fibrosis, diabetic kidney disease, spinal cord injury, autoimmune myocarditis, head and neck squamous cell carcinoma, sepsis-associated encephalopathy, abdominal aortic aneurysm, and ulcerative colitis.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	Cancer Commun (Lond); Activation of Piezo1 contributes to matrix stiffness-induced angiogenesis in hepatocellular carcinoma; Authors - Miao Li
human	WB	Exp Mol Med; H3K18 lactylation in cancer-associated fibroblasts drives malignant pleural effusion progression via TNFR2(+) T(reg) recruitment.; Authors - Linlin Ye
		Neuron; Metabolic reprogramming through histone lactylation in microglia and macrophages recruits CD8+ T lymphocytes and aggravates spinal cord injury; Authors - Xuhui Ge
mouse,human	IF	Cardiovasc Diabetol; Klotho inhibits renal ox-LDL deposition via IGF-1R/RAC1/OLR1 signaling to ameliorate podocyte injury in diabetic kidney disease; Authors - Wei Jiang
human	IHC	J Immunother Cancer; Dual regulation of CXCR6(+)CD8(+) T cells modulates cytotoxic and exhaustion-associated programs during prostate cancer progression.; Authors - Zhang Xingming
mouse	WB	Br J Pharmacol; Hydroxychloroquine cures autoimmune myocarditis by inhibiting the innate immune system via the C-X-C motif chemokine ligand 16 and C-X-C motif receptor 6 axis between macrophages and T cells; Authors - Yunling Xuan