• Featured Product
  • KD/KO Validated

CXCL16 Monoclonal antibody, PBS Only (Detector)

CXCL16 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 60123-1-PBS
Clone No.2H7B3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Small-inducible cytokine B16, Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein, CXCL 16, C-X-C motif chemokine 16, C X C motif chemokine 16

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60123-1-PBS targets CXCL16 as part of a matched antibody pair:

MP51127-1: 60123-2-PBS capture and 60123-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4883

Product name: Recombinant human CXCL16 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 46-225 aa of BC017588

Sequence: GNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATV

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 16
Calculated Molecular Weight 273 aa, 30 kDa
Observed Molecular Weight 35 kDa, 60 kDa
GenBank Accession NumberBC017588
Gene Symbol CXCL16
Gene ID (NCBI) 58191
RRIDAB_2086188
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H2A7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CXCL16 is a recently discovered cytokine belonging to the CXC chemokine family, which is synthesised in plasmacytoid dendritic cell as a transmembrane molecule. It exists in a transmembrane and soluble form. The transmembrane form of CXCL16 functions as an adhesion molecule for CXCR6-expressing cells, whereas the soluble form of CXCL16 mediates infiltration of circulating cells into sites of injury. CXCL16, has been proposed as an important pathogenic mediator in inflammatory diseases, including rheumatoid arthritis, glomerulonephritis, or prostate cancer. CXCL16 has been implicated in some forms of renal disease such as lupus nephritis and antiglomerular basement membrane nephritis. CXCL16 also plays a pivotal role in the pathogenesis of angiotensin II-induced renal injury and fibrosis through regulation of macrophage and T cell infiltration and bone marrow-derived fibroblast accumulation.

Loading...
||
New chat

Able

正在加载,请稍候...