Tested Applications
Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 35 publications below |
IHC | See 30 publications below |
IF | See 7 publications below |
ELISA | See 1 publications below |
Product Information
27095-1-AP targets CXCL8/IL-8 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, pig, zebrafish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25640 Product name: Recombinant human CXCL8/IL-8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-99 aa of BC013615 Sequence: YSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Predict reactive species |
Full Name | interleukin 8 |
Calculated Molecular Weight | 99 aa, 11 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC013615 |
Gene Symbol | IL-8 |
Gene ID (NCBI) | 3576 |
ENSEMBL Gene ID | ENSG00000169429 |
RRID | AB_2861340 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P10145 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin 8 (IL-8), also known as CXCL8, which is a member of the CXC chemokine family. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. The human IL-8 cDNA sequence predicts a protein of 99 amino acids. Removal of a 22-residue signal peptide generates a mature protein of 77 amino acids (~ 8 kDa).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CXCL8/IL-8 antibody 27095-1-AP | Download protocol |
IHC protocol for CXCL8/IL-8 antibody 27095-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Sci (Weinh) Traditional Chinese Medicine Formulae QY305 Reducing Cutaneous Adverse Reaction and Diarrhea by its Nanostructure | ||
Gut Microbes Fusobacterium nucleatum promotes esophageal squamous cell carcinoma progression and chemoresistance by enhancing the secretion of chemotherapy-induced senescence-associated secretory phenotype via activation of DNA damage response pathway | ||
Acta Pharmacol Sin Calcipotriol abrogates cancer-associated fibroblast-derived IL-8-mediated oxaliplatin resistance in gastric cancer cells via blocking PI3K/Akt signaling. | ||
iScience Analysis of microbiota reveals the underlying mechanism of PHF11 in the development of Enterococcus-regulated endometriotic cysts | ||
Int Immunopharmacol Aflatoxin B1 exposure triggers inflammation and premature skin aging via ERMCS/Ca2+/ROS signaling cascade |