Cytochrome c Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cytochrome c Polyclonal antibody (10993-1-AP)

• Featured Product
• KD/KO Validated

Cytochrome c Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 10993-1-AP

Publications(787)

Reviews (6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

CYC, CYCS

• 

  WB analysis using 10993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10993-1-AP (Cytochrome c antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10993-1-AP

  WB result of Cytochrome c antibody (10993-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytochrome c transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10993-1-AP

  WB result of Cytochrome c antibody (10993-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytochrome c transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10993-1-AP (Cytochrome c antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 10993-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 10993-1-AP (Cytochrome c Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 10993-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10993-1-AP (CYCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat skeletal muscle using 10993-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10993-1-AP (CYCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 10993-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10993-1-AP (CYCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:3000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10993-1-AP (CYCS antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10993-1-AP (CYCS antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse eye using 10993-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytochrome c antibody (10993-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse eye using 10993-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytochrome c antibody (10993-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 10993-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human Cytochrome c (10993-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, NIH/3T3 cells, rat liver tissue, HEK-293 cells, HepG2 cells, C2C12 cells, Jurkat cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human liver tissue, human breast cancer tissue, human colon cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse eye tissue
• Positive FC (Intra) detected in: HepG2 cells

This antibody is not recommended for immunocytofluorescent assays.

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10993-1-AP targets Cytochrome c in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, monkey, chicken, hamster, sheep, goat, hippospongia
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1455

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• RRID: AB_2090467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P99999
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c ca99n be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; Increased mtDNA copy number promotes cancer progression by enhancing mitochondrial oxidative phosphorylation in microsatellite-stable colorectal cancer.; Authors - Xiacheng Sun
mouse	WB	Signal Transduct Target Ther; FGF1ΔHBS prevents diabetic cardiomyopathy by maintaining mitochondrial homeostasis and reducing oxidative stress via AMPK/Nur77 suppression.; Authors - Dezhong Wang
human	IF	Signal Transduct Target Ther; DUSP6 ablation restores CAR T-cell fitness impaired by tumor CD58 loss through invigoration of AP-1 signaling.; Authors - Xinran Ma
human	WB	Cell; Tau interactome maps synaptic and mitochondrial processes associated with neurodegeneration.; Authors - Tara E Tracy
human	WB	Cell; Gasdermin E couples viral pyroptosis to lethal hepatic lipid accumulation; Authors - Chaojie Wang
human	WB	Cell Metab; Ultrasensitive sensors reveal the spatiotemporal landscape of lactate metabolism in physiology and disease; Authors - Xie Li

Reviews

5.0 out of 5

6 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Lucas (Verified Customer) (10-31-2025)

Successfully used in Western blot on mitochondrial fractions from mouse muscle. Produced strong and specific bands at a 1:1000 dilution.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse muscle cells

Kazu (Verified Customer) (12-14-2022)

Worked well for 4% PFA fixed mouse optic nerve using this antibody at dilution of 1:200. Little background observed.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse optic nerve

Azita (Verified Customer) (06-02-2021)

Western blot analysis using Cytochrome c polyclonal antibody in NSC34 cell line at dilution of 1:1000.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: NSC34

Ying (Verified Customer) (04-22-2021)

good antibody. work well with mouse cells

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000

Cytochrome c Antibody Western Blot validation (1:4000 dilution) in (Cat no:10993-1-AP)

Chi (Verified Customer) (09-26-2019)

The antibody works very well with good signal and low background.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: mouse embryonic fibroblasts

Cytochrome c Antibody Western Blot, validation (1:2000 dilution) in mouse embryonic fibroblasts (Cat no:10993-1-AP)

Xiaoping (Verified Customer) (10-22-2018)

The signal is good and the size is between 10-15kDa.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse fibroblast

Cytochrome c Antibody Western Blot, validation (1:1000 dilution) in mouse fibroblast (Cat no:10993-1-AP)