Cytochrome c Polyclonal antibody

• 

  WB analysis using 10993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10993-1-AP (Cytochrome c antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10993-1-AP

  WB result of Cytochrome c antibody (10993-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytochrome c transfected HepG2 cells.

• 

  WB analysis of HEK-293 using 10993-1-AP

  WB result of Cytochrome c antibody (10993-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytochrome c transfected HEK-293 cells.

• 

  WB analysis using 10993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10993-1-AP (Cytochrome c antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 10993-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 10993-1-AP (Cytochrome c Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 10993-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10993-1-AP (CYCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 10993-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10993-1-AP (CYCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 10993-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10993-1-AP (CYCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:3000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10993-1-AP (Cytochrome c antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10993-1-AP (CYCS antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 10993-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10993-1-AP (CYCS antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of mouse eye using 10993-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytochrome c antibody (10993-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse eye using 10993-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytochrome c antibody (10993-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HepG2 using 10993-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human Cytochrome c (10993-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

Cytochrome c Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 10993-1-AP

Publications(629)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

CYC, CYCS

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, NIH/3T3 cells, rat liver tissue, HEK-293 cells, HepG2 cells, C2C12 cells, Jurkat cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human liver tissue, human breast cancer tissue, human colon cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse eye tissue
• Positive FC (Intra) detected in: HepG2 cells

This antibody is not recommended for immunocytofluorescent assays.

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 583 publications below
• IHC: See 33 publications below
• IF: See 38 publications below
• IP: See 1 publications below
• FC: See 1 publications below

Product Information

10993-1-AP targets Cytochrome c in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, hamster, sheep, goat, hippospongia
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1455

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• RRID: AB_2090467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P99999
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c ca99n be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Tau interactome maps synaptic and mitochondrial processes associated with neurodegeneration.; Authors - Tara E Tracy
human	WB,IF	Nat Commun; MYG1 drives glycolysis and colorectal cancer development through nuclear-mitochondrial collaboration; Authors - Jianxiong Chen
human	WB	Mol Cell; Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.; Authors - Bin Jiang
human,rat	WB	Adv Sci (Weinh); Hierarchical Targeting Nanodrug with Holistic DNA Protection for Effective Treatment of Acute Kidney Injury; Authors - Qiaohui Chen
human	WB	Adv Sci (Weinh); Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy; Authors - Lihao Jin
mouse	WB	Acta Pharm Sin B; Honokiol alleviated neurodegeneration by reducing oxidative stress and improving mitochondrial function in mutant SOD1 cellular and mouse models of amyotrophic lateral sclerosis; Authors - Yujun Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kazu (Verified Customer) (12-14-2022)

Worked well for 4% PFA fixed mouse optic nerve using this antibody at dilution of 1:200. Little background observed.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse optic nerve

FH

Azita (Verified Customer) (06-02-2021)

Western blot analysis using Cytochrome c polyclonal antibody in NSC34 cell line at dilution of 1:1000.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: NSC34

FH

Ying (Verified Customer) (04-22-2021)

good antibody. work well with mouse cells

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000

Cytochrome c Antibody Western Blot validation (1:4000 dilution) in (Cat no:10993-1-AP)

FH

Chi (Verified Customer) (09-26-2019)

The antibody works very well with good signal and low background.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: mouse embryonic fibroblasts

Cytochrome c Antibody Western Blot, validation (1:2000 dilution) in mouse embryonic fibroblasts (Cat no:10993-1-AP)

FH

Xiaoping (Verified Customer) (10-22-2018)

The signal is good and the size is between 10-15kDa.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse fibroblast

Cytochrome c Antibody Western Blot, validation (1:1000 dilution) in mouse fibroblast (Cat no:10993-1-AP)