Tissue Factor/CD142 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Tissue Factor/CD142 Recombinant monoclonal antibody (83776-4-RR)

Tissue Factor/CD142 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83776-4-RR Copied!

Clone No. 240784H6

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, 240784H6

• 

  WB analysis of HepG2 using 83776-4-RR

  HepG2 cells were subjected to SDS PAGE followed by western blot with 83776-4-RR (Tissue Factor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 83776-4-RR

  A431 cells were subjected to SDS PAGE followed by western blot with 83776-4-RR (Tissue Factor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 83776-4-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83776-4-RR (Tissue Factor antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 83776-4-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Tissue Factor antibody (83776-4-RR, Clone: 240784H6 ) at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83776-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83776-4-RR against Human Coagulation Factor III/Tissue Factor were performed. The affinity constant is 0.131 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Tissue Factor/CD142 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, A431 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83776-4-RR targets Tissue Factor/CD142 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1052

  Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 33-251 aa of NM_001993.5

  Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Full Name: coagulation factor III (thromboplastin, tissue factor)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_001993.5
• Gene Symbol: F3
• Gene ID (NCBI): 2152
• RRID: AB_3671371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13726-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).

Publications

What published studies show

The antibody 83776-4-RR (a human recombinant antibody targeting Coagulation Factor 3) has 1 total citation. It appears in Frontiers in Bioscience-Landmark (2025), where it was used for IHC in a single-cell sequencing study investigating cell subtypes with high F3 expression and their roles in pancreatic ductal adenocarcinoma. The associated research field is oncology, specifically pancreatic cancer and coagulation biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Biosci (Landmark Ed); Single-cell Sequencing Analysis Reveals Cell Subtypes With High Expression of Coagulation Factor 3 and Their Possible Roles in Pancreatic Ductal Adenocarcinoma.; Authors - Chunyan Wang