Tissue Factor/CD142 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 83776-4-RR (same clone as 83776-4-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 83776-4-RR (Tissue Factor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83776-4-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 83776-4-RR (same clone as 83776-4-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 83776-4-RR (Tissue Factor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83776-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 83776-4-RR (same clone as 83776-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83776-4-RR (Tissue Factor antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9). This data was developed using the same antibody clone with 83776-4-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 83776-4-RR (same clone as 83776-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Tissue Factor antibody (83776-4-RR, Clone: 240784H6 ) at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83776-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83776-4-PBS

  Biolayer interferometry (BLl) kinetic assays of 83776-4-PBS against Human Coagulation Factor III/Tissue Factor were performed. The affinity constant is 0.131 nM.

• 

  Affinity and Kinetic Characterization of 83776-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83776-4-RR against Human Coagulation Factor III/Tissue Factor were performed. The affinity constant is 0.131 nM.

Tissue Factor/CD142 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83776-4-PBS

Clone No.240784H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, 240784H6

---

Product Information

83776-4-PBS targets Tissue Factor/CD142 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1052

  Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 33-251 aa of NM_001993.5

  Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Full Name: coagulation factor III (thromboplastin, tissue factor)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_001993.5
• Gene Symbol: F3
• Gene ID (NCBI): 2152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P13726-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).