DBF4B Polyclonal antibody

• 

  WB analysis using 26214-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26214-1-AP (DBF4B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

DBF4B Polyclonal Antibody for WB, ELISA

Cat No. 26214-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ASK like protein 1, ASKL1, chifb, Chiffon homolog B, DBF4 homolog B (S. cerevisiae), Dbf4 related factor 1, DBF4B, DRF1, Protein DBF4 homolog B, ZDBF1B

---

Tested Applications

• Positive WB detected in: PC-3 cells, T-47D cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26214-1-AP targets DBF4B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23889

  Product name: Recombinant human DBF4B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 60-297 aa of BC016158

  Sequence: GKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLCVKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRK

• Full Name: DBF4 homolog B (S. cerevisiae)
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC016158
• Gene Symbol: DBF4B
• Gene ID (NCBI): 80174
• RRID: AB_3669528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell-cycle progression is driven by orderly activation of many kinases including the DBF4/DBF4B-dependent S-phase promoting kinase Cdc7. Binding of Cdc7 to its subunit DBF4 or DBF4B (also known as DRF1/ASKL1) is thought to be a key regulatory event that controls Cdc7 activity in human cells.