Recombinant human DBF4B protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag23889
Synonyms
DBF4B, Activator of S phase kinase-like protein 1, ASKL1, ASK-like protein 1, chifb
Validation Data Gallery View All
Product Information
| Peptide Sequence |
GKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLCVKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRK
(60-297 aa encoded by BC016158) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
