• Featured Product
  • KD/KO Validated

DBR1 Polyclonal antibody

DBR1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16019-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Lariat debranching enzyme, EC:3.1.4.-

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman brain tissue, HepG2 cells, HeLa cells
Positive IP detected inmouse brain tissue, HeLa cells
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16019-1-AP targets DBR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8830

Product name: Recombinant human DBR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 204-544 aa of BC009472

Sequence: TLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDPSKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA

Predict reactive species
Full Name debranching enzyme homolog 1 (S. cerevisiae)
Calculated Molecular Weight 544 aa, 62 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC009472
Gene Symbol DBR1
Gene ID (NCBI) 51163
RRIDAB_2230316
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UK59
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DBR1(Lariat debranching enzyme) hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules. DBR1 belongs to the lariat debranching enzyme family. Inhibiton of Dbr1 can suppress TDP-43 toxicity in primary neurons, suggesting that Dbr1 could be a potential therapeutic target for ALS and related TDP-43 proteinopathies (PMID: 23104007). This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
WB protocol for DBR1 antibody 16019-1-APDownload protocol
IHC protocol for DBR1 antibody 16019-1-APDownload protocol
IF protocol for DBR1 antibody 16019-1-APDownload protocol
IP protocol for DBR1 antibody 16019-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Genet

Inhibition of RNA lariat debranching enzyme suppresses TDP-43 toxicity in ALS disease models.

Authors - Armakola Maria M
  • KD Validated
humanWB

Cell

Inborn Errors of RNA Lariat Metabolism in Humans with Brainstem Viral Infection.

Authors - Shen-Ying Zhang
humanWB

J Exp Med

SARS-CoV-2 brainstem encephalitis in human inherited DBR1 deficiency

Authors - Yi-Hao Chan
humanWB

Mol Cell Proteomics

Cell cycle regulation of microtubule interactomes: multi-layered regulation is critical for the interphase/mitosis transition.

Authors - Syred Heather M HM
humanIF

PLoS One

Inhibition of U4 snRNA in Human Cells Causes the Stable Retention of Polyadenylated Pre-mRNA in the Nucleus.

Authors - Anne Hett
humanWB, IHC

Int J Mol Sci

Identification of the specific interactors of the human lariat RNA debranching enzyme 1 protein.

Authors - So Masaki

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marta (Verified Customer) (02-18-2020)

Single band in the WB at the expected size, incubated overnight at 4C with a 1/1200 dilution

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1200
  • Cell Tissue Type: PBMC, B-EBV cells
DBR1 Antibody Western Blot, validation (1/1200 dilution) in PBMC, B-EBV cells (Cat no:16019-1-AP)
FH

Aiswarya (Verified Customer) (12-23-2019)

The Dbr1 antibody was used to check knock down of Dbr1 and worked well. Additional non specific bands come up but do not interfere in the specific size range.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HAP1, HEK293
Loading...