Tested Applications
| Positive WB detected in | human brain tissue, HepG2 cells, HeLa cells |
| Positive IP detected in | mouse brain tissue, HeLa cells |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16019-1-AP targets DBR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8830 Product name: Recombinant human DBR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 204-544 aa of BC009472 Sequence: TLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDPSKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA Predict reactive species |
| Full Name | debranching enzyme homolog 1 (S. cerevisiae) |
| Calculated Molecular Weight | 544 aa, 62 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC009472 |
| Gene Symbol | DBR1 |
| Gene ID (NCBI) | 51163 |
| RRID | AB_2230316 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UK59 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DBR1(Lariat debranching enzyme) hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules. DBR1 belongs to the lariat debranching enzyme family. Inhibiton of Dbr1 can suppress TDP-43 toxicity in primary neurons, suggesting that Dbr1 could be a potential therapeutic target for ALS and related TDP-43 proteinopathies (PMID: 23104007). This protein has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DBR1 antibody 16019-1-AP | Download protocol |
| IHC protocol for DBR1 antibody 16019-1-AP | Download protocol |
| IP protocol for DBR1 antibody 16019-1-AP | Download protocol |
| WB protocol for DBR1 antibody 16019-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DBR1 Polyclonal antibody (Cat# 16019-1-AP) has 12 citations. These appear in journals including Cell, Nature Genetics, Nature Communications, Journal of Experimental Medicine, EMBO Journal, Molecular & Cellular Proteomics, International Journal of Molecular Sciences, PLoS ONE, and Technological Cancer Research & Treatment. Research fields span RNA lariat metabolism, intron splicing, ALS/TDP-43 neurodegeneration, antiviral immunity, viral infection, and esophageal cancer.
| Species | Application | Title |
|---|---|---|
Nat Genet Inhibition of RNA lariat debranching enzyme suppresses TDP-43 toxicity in ALS disease models.
| ||
J Exp Med Human DBR1 deficiency impairs stress granule-dependent PKR antiviral immunity
| ||
EMBO J Noncanonical circRNA biogenesis driven by alpha and gamma herpesviruses
|
Reviews
What customers say
Both reviewers rated the antibody 4 out of 5 stars for Western Blot. One user reported a clean single band at the expected molecular weight using a 1/1200 dilution with overnight incubation at 4°C on PBMC and B-EBV cell lysates. The other user confirmed effective detection for Dbr1 knockdown validation in HAP1 and HEK293 cells at 1:1000 dilution, noting minor non-specific bands that did not interfere with the target range. Overall, the antibody performs reliably for WB with good specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marta (Verified Customer) (02-18-2020) | Single band in the WB at the expected size, incubated overnight at 4C with a 1/1200 dilution
 |
Aiswarya (Verified Customer) (12-23-2019) | The Dbr1 antibody was used to check knock down of Dbr1 and worked well. Additional non specific bands come up but do not interfere in the specific size range.
|
