DCBLD2 Recombinant monoclonal antibody, PBS Only (Detector)

DCBLD2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85000-2-PBS
Clone No.242604F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

CLCP1, CUB, LCCL and coagulation factor V/VIII-homology domains protein 1, Discoidin, CUB and LCCL domain-containing protein 2, Endothelial and smooth muscle cell-derived neuropilin-like protein, ESDN

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85000-2-PBS targets DCBLD2 as part of a matched antibody pair:

MP01733-1: 85000-3-PBS capture and 85000-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32823

Product name: Recombinant human DCBLD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 582-743 aa of BC029658

Sequence: LQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL

Predict reactive species
Full Name discoidin, CUB and LCCL domain containing 2
Calculated Molecular Weight 775 aa, 89 kDa
GenBank Accession NumberBC029658
Gene Symbol DCBLD2
Gene ID (NCBI) 131566
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96PD2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...