DDIT4L Polyclonal antibody

• 

  WB analysis of mouse ovary using 12094-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 12094-1-AP (DDIT4L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

DDIT4L Polyclonal Antibody for WB, ELISA

Cat No. 12094-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

DNA damage-inducible transcript 4-like protein, HIF-1 responsive protein RTP801-like, REDD2, REDD-2, RTP801L

---

Tested Applications

• Positive WB detected in: mouse ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

12094-1-AP targets DDIT4L in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2735

  Product name: Recombinant human DDIT4L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC013592

  Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS

• Full Name: DNA-damage-inducible transcript 4-like
• Calculated Molecular Weight: 193 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC013592
• Gene Symbol: DDIT4L
• Gene ID (NCBI): 115265
• RRID: AB_2918027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96D03
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA-damage-inducible transcript 4-like protein(DDIT4L), encoded by the stress responsive gene REDD2, is a negative regulator of mTOR signaling, and expressed predominantly in skeletal muscle. It regulates the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Also, DDIT4L involves in oxidized low-density lipoprotein-induced macrophage death sensitivity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	J Cell Sci; Oocyte-dependent activation of MTOR in cumulus cells controls the development and survival of cumulus-oocyte complexes.; Authors - Jing Guo
		J Nutr; Amino Acid- and Insulin-Induced Activation of Mechanistic Target of Rapamycin Complex 1 in Neonatal Piglet Skeletal Muscle Involves Sestin2-GATOR2, Rag A/C-mTOR, and RHEB-mTOR Complex Formation.; Authors - Agus Suryawan
		J Cell Biochem; Regulation of REDD1 by insulin-like growth factor-I in skeletal muscle and myotubes.; Authors - Frost Robert A RA
mouse	WB	Am J Physiol Endocrinol Metab; Disruption of REDD1 gene ameliorates sepsis-induced decrease in mTORC1 signaling but has divergent effects on proteolytic signaling in skeletal muscle.; Authors - Jennifer L Steiner