Recombinant human DDR2 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag28183
Synonyms
DDR2, Discoidin domain receptor 2, MIG20a, NTRKR3, TKT
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT
(291-398 aa encoded by NM_001014796) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
