Tested Applications
Positive WB detected in | mouse heart tissue, mouse skeletal muscle tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
22205-1-AP targets Desmin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17525 Product name: Recombinant human DES protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032116 Sequence: MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDF Predict reactive species |
Full Name | desmin |
Calculated Molecular Weight | 470 aa, 54 kDa |
Observed Molecular Weight | 50-55 kDa |
GenBank Accession Number | BC032116 |
Gene Symbol | Desmin |
Gene ID (NCBI) | 1674 |
RRID | AB_2879027 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P17661 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Desmin antibody 22205-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |