DGCR2 Polyclonal antibody, PBS Only

• 

  IHC staining of human brain using 13705-1-AP (same clone as 13705-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13705-1-AP (DGCR2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13705-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 13705-1-AP (same clone as 13705-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13705-1-AP (DGCR2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13705-1-PBS in a different storage buffer formulation.

DGCR2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 13705-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

13705-1-PBS targets DGCR2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4629

  Product name: Recombinant human DGCR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC032430

  Sequence: MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQCDGWATCEDESDEANCPEVTGEVRPHHGKEAVDPRQGRARGGDPSHFHAVNVAQPVRFSSFLGKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHG

• Full Name: DiGeorge syndrome critical region gene 2
• Calculated Molecular Weight: 550 aa, 61 kDa
• Observed Molecular Weight: 61-65 kDa
• GenBank Accession Number: BC032430
• Gene Symbol: DGCR2
• Gene ID (NCBI): 9993
• RRID: AB_10644148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P98153
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.