• Featured Product
  • KD/KO Validated

DHX9 Polyclonal antibody

DHX9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17721-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

NDH II, LKP, EC:3.6.4.13, DExH-box helicase 9, DDX9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse testis tissue, rat spleen tissue, rat testis tissue, Jurkat cells
Positive IHC detected inmouse brain tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17721-1-AP targets DHX9 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12104

Product name: Recombinant human DHX9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC014246

Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP

Predict reactive species
Full Name DEAH (Asp-Glu-Ala-His) box polypeptide 9
Calculated Molecular Weight 1270 aa, 141 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC014246
Gene Symbol DHX9
Gene ID (NCBI) 1660
RRIDAB_2092506
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ08211
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain [PMID:20569003]. It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2[PMID: 19029303, 22190748].

Protocols

Product Specific Protocols
IF protocol for DHX9 antibody 17721-1-APDownload protocol
IHC protocol for DHX9 antibody 17721-1-APDownload protocol
WB protocol for DHX9 antibody 17721-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Hepatology

Splicing Regulator p54nrb /NONO Enhances Carcinogenesis Through Oncogenic Isoform Switch of BIN1 in Hepatocellular Carcinoma.

Authors - Zhixiang Hu
mouseWB

Sci Adv

R-loops coordinate with SOX2 in regulating reprogramming to pluripotency.

Authors - Yaoyi Li
humanRIP

Nat Commun

Structural basis for terminal loop recognition and stimulation of pri-miRNA-18a processing by hnRNP A1.

Authors - Hamed Kooshapur
humanWB

Nat Commun

Interaction of 7SK with the Smn complex modulates snRNP production.

Authors - Changhe Ji
humanWB

Nat Commun

TASOR epigenetic repressor cooperates with a CNOT1 RNA degradation pathway to repress HIV.

Authors - Roy Matkovic
humanWB

Nat Commun

PMID: 31792210

Authors - Sunwang Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sonam (Verified Customer) (10-16-2025)

Good Ab

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Macrophages
FH

Roy (Verified Customer) (06-12-2024)

Strong DHX9 band detected at the right size by WB (1/1000- 1h incubation at RT) with HeLa extracts.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa
Loading...
||
New chat Able
正在加载,请稍候...