CoraLite® Plus 488-conjugated DHX9 Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-67153

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 DHX9 antibody (CL488-67153, Clone: 1B12C10 ) at dilution of 1:400.

• 

  IF Staining of HepG2 using CL488-67153

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 DHX9 antibody (CL488-67153, Clone: 1B12C10 ) at dilution of 1:200.

• 

  FC experiment of Jurkat using CL488-67153

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human DHX9 (CL488-67153, Clone:1B12C10) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

DHX9 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67153

Clone No.1B12C10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

LKP, EC:3.6.4.13, DExH-box helicase 9, DDX9, ATP-dependent RNA helicase A

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67153 targets DHX9 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12104

  Product name: Recombinant human DHX9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC014246

  Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP

• Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9
• Calculated Molecular Weight: 1270 aa, 141 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC014246
• Gene Symbol: DHX9
• Gene ID (NCBI): 1660
• RRID: AB_2919429
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q08211
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain [PMID:20569003]. It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2[PMID: 19029303, 22190748].