CRMP2 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83990-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83990-1-PBS against Human CRMP2 was performed. The affinity constant is below 1 pM.

CRMP2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83990-1-PBS

Clone No.241088A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

DPYSL2, CRMP-2, DHPRP2, Dihydropyrimidinase-related protein 2, DRP2

---

Product Information

83990-1-PBS targets CRMP2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5987

  Product name: Recombinant human DPYSL2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 224-572 aa of BC067109

  Sequence: VLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

• Full Name: dihydropyrimidinase-like 2
• Calculated Molecular Weight: 62 kDa
• GenBank Accession Number: BC067109
• Gene Symbol: CRMP2
• Gene ID (NCBI): 1808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16555
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.