Tested Applications
| Positive WB detected in | A431 cells, HepG2 cells, mouse heart tissue, BxPC-3 cells, HEK-293 cells |
| Positive IP detected in | BxPC-3 cells |
| Positive IHC detected in | rat heart tissue, human normal colon, human bowen disease, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:750-1:3000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25318-1-AP targets Desmoplakin in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18065 Product name: Recombinant human DSP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC140802 Sequence: MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAY Predict reactive species |
| Full Name | desmoplakin |
| Calculated Molecular Weight | 2871 aa, 332 kDa |
| Observed Molecular Weight | 240-330 kDa |
| GenBank Accession Number | BC140802 |
| Gene Symbol | DSP |
| Gene ID (NCBI) | 1832 |
| RRID | AB_2880028 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15924 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The desmoplakin (DP) is the most abundant desmosomal proteins and is located at the cytoplasmic portion of the desmosomes which are specialized cell-cell adhesion structures abundant in tissues such as muscle and epidermis that are subjected to mechanical stress. Desmoplakin 1 and 2 (DP 1 and 2) are two splice variants sharing common C-terminal and N-terminal globular head and tail domains, but differ in the length of the rod domain that links them. This antibody detects both DP1 (280-330 kDa) and DP2 (240-260 kDa). (PMID: 16467215, 11781569)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Desmoplakin antibody 25318-1-AP | Download protocol |
| IF protocol for Desmoplakin antibody 25318-1-AP | Download protocol |
| IHC protocol for Desmoplakin antibody 25318-1-AP | Download protocol |
| IP protocol for Desmoplakin antibody 25318-1-AP | Download protocol |
| WB protocol for Desmoplakin antibody 25318-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Desmoplakin antibody (Cat# 25318-1-AP) has 30 citations spanning journals including Nature Communications, Science Advances, Developmental Cell, Cell Reports, Theranostics, Advanced Science, Cancer Letters, and others. Research fields cover desmosome biology, cardiac function and disease, cancer (breast, renal, colorectal, esophageal), skin development, atopic dermatitis, epithelial-mesenchymal transition, viral infections, and Wnt/β-catenin signaling. Applications include WB, IF, IHC, CoIP, and IP across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Bone Res Overexpression of Lrp5 enhanced the anti-breast cancer effects of osteocytes in bone. | ||
Nat Commun CCDC120 phase separation contributes to desmosomal integrity and cardiac function | ||
Nat Commun Actomyosin forces trigger a conformational change in desmoplakin within desmosomes. | ||
Theranostics Cdc42 Deficiency Leads To Epidermal Barrier Dysfunction by Regulating Intercellular Junctions and Keratinization of Epidermal Cells during Mouse Skin Development. | ||
J Exp Clin Cancer Res GTSE1 is involved in breast cancer progression in p53 mutation-dependent manner. | ||
Adv Sci (Weinh) Targeting Supramolecular Active Complexes of Na(v)1.7/Na(v)1.8 to Relieve Chronic Neuropathic Pain. |
