ECSIT Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83295-5-RR (same clone as 83295-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83295-5-RR (ECSIT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83295-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 83295-5-RR (same clone as 83295-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 83295-5-RR (ECSIT antibody) at dilution of 1:250 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83295-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 83295-5-RR (same clone as 83295-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 83295-5-RR (ECSIT antibody) at dilution of 1:250 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83295-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 83295-5-RR (same clone as 83295-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ECSIT antibody (83295-5-RR, Clone: 240223G2 ) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 83295-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83295-5-RR (same clone as 83295-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug ECSIT Recombinant antibody (83295-5-RR, Clone:240223G2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83295-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83295-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83295-5-RR against Human ECSIT were performed. The affinity constant is 1.95 nM.

ECSIT Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83295-5-PBS

Clone No.240223G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

SITPEC, Protein SITPEC, ECSIT homolog (Drosophila), 240223G2

---

Product Information

83295-5-PBS targets ECSIT in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26898

  Product name: Recombinant human ECSIT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 49-267 aa of BC008279

  Sequence: SSEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGS

• Full Name: ECSIT homolog (Drosophila)
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC008279
• Gene Symbol: ECSIT
• Gene ID (NCBI): 51295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BQ95
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ECSIT is a cytosolic adaptor protein associated with the toll-like receptor pathway. It has a distinct N-terminal mitochondrial targeting sequence, pentatricopeptide repeat motif, and a C-terminal pleckstrin homology domain. ECSIT regulates many biological processes like embryonic development, inflammation, cardiac function, and assembly of mitochondrial complex I. In macrophages, the activation of TLRs by inflammatory signals promotes the translocation of TRAF6 to mitochondria where it engages ECSIT to stimulate the production of mitochondrial reactive oxygen species (ROS).