Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, mouse liver tissue, mouse skeletal muscle tissue, MCF-7 cells, mouse pancreas tissue, mouse ovary tissue, mouse heart tissue, rat brain tissue, human brain tissue, Jurkat cells, SH-SY5Y cells, Neuro-2a cells, C2C12 cells, HepG2 cells, mouse brain tissue |
Positive IHC detected in | mouse brain tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 6 publications below |
WB | See 25 publications below |
IHC | See 4 publications below |
IF | See 7 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
RIP | See 1 publications below |
Product Information
11402-1-AP targets EEF1A1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, zebrafish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1938 Product name: Recombinant human EEF1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 144-462 aa of BC014224 Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK Predict reactive species |
Full Name | eukaryotic translation elongation factor 1 alpha 1 |
Calculated Molecular Weight | 462 aa, 50 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC014224 |
Gene Symbol | EEF1A1 |
Gene ID (NCBI) | 1915 |
RRID | AB_2096966 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P68104 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EEF1A1, also named as EEF1A, EF1A and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. It is a typical housekeeping gene product required for the maintenance of cell growth and/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human EEF1A1.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EEF1A1 antibody 11402-1-AP | Download protocol |
IHC protocol for EEF1A1 antibody 11402-1-AP | Download protocol |
IF protocol for EEF1A1 antibody 11402-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab High dietary fructose promotes hepatocellular carcinoma progression by enhancing O-GlcNAcylation via microbiota-derived acetate | ||
Nat Commun Immunoproteasome-specific subunit PSMB9 induction is required to regulate cellular proteostasis upon mitochondrial dysfunction
| ||
Nat Chem Biol Gelation of cytoplasmic expanded CAG RNA repeats suppresses global protein synthesis | ||
Sci Adv CGG repeat RNA G-quadruplexes interact with FMRpolyG to cause neuronal dysfunction in fragile X-related tremor/ataxia syndrome. | ||
Dev Cell DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tom (Verified Customer) (08-25-2020) | This antibody successfully detects EEF1A1 in western blots. There was one specific and strong band at 50 kDa.
|