EIF3D Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82512-1-RR (same clone as 82512-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82512-1-RR (EIF3D antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 82512-1-RR (same clone as 82512-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 82512-1-RR (EIF3D antibody) at dilution of 1:30300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 82512-1-RR (same clone as 82512-1-PBS)

  WB result of EIF3D antibody (82512-1-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EIF3D transfected HEK-293 cells. This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A549 using 82512-1-RR (same clone as 82512-1-PBS)

  IP result of anti-EIF3D (IP:82512-1-RR, 4ug; Detection:82512-1-RR 1:5000) with A549 cells lysate 920 ug. This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 82512-1-RR (same clone as 82512-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 82512-1-RR (EIF3D antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 82512-1-RR (same clone as 82512-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 82512-1-RR (EIF3D antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 82512-1-RR (same clone as 82512-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using EIF3D antibody (82512-1-RR, Clone: 3O8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 82512-1-RR (same clone as 82512-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using EIF3D antibody (82512-1-RR, Clone: 3O8 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 82512-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82512-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82512-1-RR against Human EIF3D were performed. The affinity constant is 5.83 nM.

• Featured Product
• KD/KO Validated

EIF3D Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 82512-1-PBS

Clone No.3O8

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

eIF-3-zeta, EIF3S7, eIF3 zeta, eIF3 p66, eIF 3 zeta

---

Product Information

82512-1-PBS targets EIF3D in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0268

  Product name: Recombinant human EIF3D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-531 aa of BC000328

  Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE

• Full Name: eukaryotic translation initiation factor 3, subunit D
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC000328
• Gene Symbol: EIF3D
• Gene ID (NCBI): 8664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15371
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.