EPRS Monoclonal antibody

• 

  WB analysis using 67712-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67712-1-Ig

  WB result of EPRS antibody (67712-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPRS transfected HeLa cells.

• 

  WB analysis of HSC-T6 using 67712-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-12 using 67712-1-Ig

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67712-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 67712-1-Ig

  IP result of anti-EPRS (IP:67712-1-Ig, 4ug; Detection:67712-1-Ig 1:10000) with HeLa cells lysate 1085 ug.

• 

  IHC staining of human lung cancer using 67712-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67712-1-Ig (EPRS antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 67712-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67712-1-Ig (EPRS antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67712-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EPRS antibody (67712-1-Ig, Clone: 1B7G2 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 67712-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EPRS antibody (67712-1-Ig, Clone: 1B7G2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue).

• 

  IF Staining of BV-2 using 67712-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed BV-2 cells using EPRS antibody (67712-1-Ig, Clone: 1B7G2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

• Featured Product
• KD/KO Validated

EPRS Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 67712-1-Ig

Clone No.1B7G2

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EPRS1, 1B7G2, Bifunctional aminoacyl-tRNA synthetase, Bifunctional glutamate/proline--tRNA ligase, Cell proliferation-inducing gene 32 protein

---

Tested Applications

• Positive WB detected in: HT-29 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, PC-12 cells, HEK-293 cells, HepG2 cells, LNCaP cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, BV-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

67712-1-Ig targets EPRS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19184

  Product name: Recombinant human EPRS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1163-1512 aa of BC126275

  Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY

• Full Name: glutamyl-prolyl-tRNA synthetase
• Calculated Molecular Weight: 1512 aa, 171 kDa
• Observed Molecular Weight: 171 kDa
• GenBank Accession Number: BC126275
• Gene Symbol: EPRS
• Gene ID (NCBI): 2058
• RRID: AB_2882902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07814
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human EPRS is a 172 kDa, 1512 amino acid polypeptide consisting of three major domains. The N and C termini contain ERS and PRS catalytic domains, respectively, joined by a 300 amino acid linker containing three tandem WHEP-TRS (referred to as WHEP) domains. EPRS is a bifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. EPRS has a special role in GAIT-mediated translational control, as it is solely responsible for recognition and interaction with GAIT elements in target mRNAs. (PMID: 29576217, PMID: 22386318, PMID: 19647514)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC,IF	Kaohsiung J Med Sci; Evodiamine inhibits EPRS expression to regulate glutamate metabolism and proliferation of oral squamous cell carcinoma cells; Authors - Li-Qi Lin