EPRS Monoclonal antibody

• Home
• Products
• Primary Antibodies
• EPRS Monoclonal antibody (67712-1-Ig)

• Featured Product
• KD/KO Validated

EPRS Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 67712-1-Ig Copied!

Clone No. 1B7G2

Publications (5)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EPRS1, 1B7G2, Bifunctional aminoacyl-tRNA synthetase, Bifunctional glutamate/proline--tRNA ligase, Cell proliferation-inducing gene 32 protein

• 

  WB analysis using 67712-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67712-1-Ig

  WB result of EPRS antibody (67712-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPRS transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 67712-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-12 using 67712-1-Ig

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 67712-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67712-1-Ig (EPRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 67712-1-Ig

  IP result of anti-EPRS (IP:67712-1-Ig, 4ug; Detection:67712-1-Ig 1:10000) with HeLa cells lysate 1085 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67712-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67712-1-Ig (EPRS antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67712-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67712-1-Ig (EPRS antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67712-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EPRS antibody (67712-1-Ig, Clone: 1B7G2 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67712-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EPRS antibody (67712-1-Ig, Clone: 1B7G2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of BV-2 using 67712-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed BV-2 cells using EPRS antibody (67712-1-Ig, Clone: 1B7G2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EPRS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-29 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, PC-12 cells, HEK-293 cells, HepG2 cells, LNCaP cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, BV-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67712-1-Ig targets EPRS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19184

  Product name: Recombinant human EPRS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1163-1512 aa of BC126275

  Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY

• Full Name: glutamyl-prolyl-tRNA synthetase
• Calculated Molecular Weight: 1512 aa, 171 kDa
• Observed Molecular Weight: 171 kDa
• GenBank Accession Number: BC126275
• Gene Symbol: EPRS
• Gene ID (NCBI): 2058
• RRID: AB_2882902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07814
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human EPRS is a 172 kDa, 1512 amino acid polypeptide consisting of three major domains. The N and C termini contain ERS and PRS catalytic domains, respectively, joined by a 300 amino acid linker containing three tandem WHEP-TRS (referred to as WHEP) domains. EPRS is a bifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. EPRS has a special role in GAIT-mediated translational control, as it is solely responsible for recognition and interaction with GAIT elements in target mRNAs. (PMID: 29576217, PMID: 22386318, PMID: 19647514)

Publications

What published studies show

The EPRS Monoclonal antibody (1B7G2), catalog number 67712-1-Ig, has 5 citations published in Nature Biotechnology, Genes & Development, iScience, Toxicology and Applied Pharmacology, and Kaohsiung Journal of Medical Sciences. The associated research fields include mRNA translation regulation, stress granule biology, tRNA synthetase complex and ER organization, colon cancer treatment, and oral squamous cell carcinoma.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Biotechnol; Programmable initiation of mRNA translation by trans-RNA; Authors - Longfei Jia
		Genes Dev; Ribosome association inhibits stress-induced gene mRNA localization to stress granules; Authors - Noah S Helton
human, mouse, rat	WB,IP,IF	iScience; Variant-specific interaction of kinectin 1 with the multi-tRNA synthetase complex regulates ER sheet organization.; Authors - Masaki Hosogane
human	WB	Toxicol Appl Pharmacol; The glutamyl-prolyl-tRNA synthetase 1 inhibitor halofuginone exerts synergistic antitumor effects with bortezomib in colon cancer cells.; Authors - Han Lin ; KD Validated
mouse,human	WB,IHC,IF	Kaohsiung J Med Sci; Evodiamine inhibits EPRS expression to regulate glutamate metabolism and proliferation of oral squamous cell carcinoma cells; Authors - Li-Qi Lin