• Featured Product
  • KD/KO Validated

EPRS Monoclonal antibody

EPRS Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 67712-1-Ig
Clone No.1B7G2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

EPRS1, 1B7G2, Bifunctional aminoacyl-tRNA synthetase, Bifunctional glutamate/proline--tRNA ligase, Cell proliferation-inducing gene 32 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, PC-12 cells, HEK-293 cells, HepG2 cells, LNCaP cells, Jurkat cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, BV-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67712-1-Ig targets EPRS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19184

Product name: Recombinant human EPRS protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1163-1512 aa of BC126275

Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY

Predict reactive species
Full Name glutamyl-prolyl-tRNA synthetase
Calculated Molecular Weight 1512 aa, 171 kDa
Observed Molecular Weight171 kDa
GenBank Accession NumberBC126275
Gene Symbol EPRS
Gene ID (NCBI) 2058
RRIDAB_2882902
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07814
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human EPRS is a 172 kDa, 1512 amino acid polypeptide consisting of three major domains. The N and C termini contain ERS and PRS catalytic domains, respectively, joined by a 300 amino acid linker containing three tandem WHEP-TRS (referred to as WHEP) domains. EPRS is a bifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. EPRS has a special role in GAIT-mediated translational control, as it is solely responsible for recognition and interaction with GAIT elements in target mRNAs. (PMID: 29576217, PMID: 22386318, PMID: 19647514)

Protocols

Product Specific Protocols
IF protocol for EPRS antibody 67712-1-IgDownload protocol
IHC protocol for EPRS antibody 67712-1-IgDownload protocol
IP protocol for EPRS antibody 67712-1-IgDownload protocol
WB protocol for EPRS antibody 67712-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IHC,IF

Kaohsiung J Med Sci

Evodiamine inhibits EPRS expression to regulate glutamate metabolism and proliferation of oral squamous cell carcinoma cells

Authors - Li-Qi Lin
Loading...
||
New chat Able
正在加载,请稍候...