CoraLite® Plus 647-conjugated EPRS Monoclonal antibody

• 

  IF Staining of HeLa using CL647-67712

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 647 EPRS antibody (CL647-67712, Clone: 1B7G2 ) at dilution of 1:200.

EPRS Monoclonal Antibody for IF/ICC

Cat No. CL647-67712

Clone No.1B7G2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, mouse

Applications

IF/ICC

Synonyms

DKFZp313B047, EARS, EPRS, GLNS, GLUPRORS, GluRS Prolyl tRNA synthetase, Glutamate tRNA ligase, PARS, PIG32, Proline tRNA ligase, QARS, QPRS

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-67712 targets EPRS in IF/ICC applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19184

  Product name: Recombinant human EPRS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1163-1512 aa of BC126275

  Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY

• Full Name: glutamyl-prolyl-tRNA synthetase
• Calculated Molecular Weight: 1512 aa, 171 kDa
• GenBank Accession Number: BC126275
• Gene Symbol: EPRS
• Gene ID (NCBI): 2058
• RRID: AB_2920300
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07814
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Human EPRS is a 172 kDa, 1512 amino acid polypeptide consisting of three major domains. The N and C termini contain ERS and PRS catalytic domains, respectively, joined by a 300 amino acid linker containing three tandem WHEP-TRS (referred to as WHEP) domains. EPRS is a bifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. EPRS has a special role in GAIT-mediated translational control, as it is solely responsible for recognition and interaction with GAIT elements in target mRNAs. (PMID: 29576217, PMID: 22386318, PMID: 19647514)