ETV4 Recombinant monoclonal antibody

• 

  WB analysis of K-562 using 83891-6-RR

  K-562 cells were subjected to SDS PAGE followed by western blot with 83891-6-RR (ETV4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 83891-6-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 83891-6-RR (ETV4 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 83891-6-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83891-6-RR (ETV4 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 83891-6-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ETV4 antibody (83891-6-RR, Clone: 241042E10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of U2OS using 83891-6-RR

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug ETV4 Recombinant antibody (83891-6-RR, Clone:241042E10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

• 

  Affinity and Kinetic Characterization of 83891-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83891-6-RR against Human ETV4 were performed. The affinity constant is 0.157 nM.

ETV4 Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83891-6-RR

Clone No.241042E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

PEA3, ETS translocation variant 4, E1A-F, E1AF, Adenovirus E1A enhancer-binding protein

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IHC detected in: human colon cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83891-6-RR targets ETV4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0984

  Product name: Recombinant human ETV4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-207 aa of BC007242

  Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY

• Full Name: ets variant 4
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 61-65 kDa
• GenBank Accession Number: BC007242
• Gene Symbol: ETV4
• Gene ID (NCBI): 2118
• RRID: AB_3671474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P43268
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ETS translocation variant 4 (ETV4), also named as E1A-F or PEA3, is 484 amino acid protein, which contains one ETS DNA-binding domain and belongs to the ETS family. The calculated molecular weight of ETV4 protein is 54 kDa, but the phosphorylated ETV4 is a 54-61 kDa protein. ETV4 as a transcription activator localizes in the nucleus and binds to the enhancer of the adenovirus E1A gene.