Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EXOC1 Polyclonal antibody

EXOC1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

BM 102, Exocyst complex component 1, Exocyst complex component Sec3, SEC3, SEC3L1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for EXOC1 in ?

Tested Applications

Positive WB detected inHEK-293 cells, human brain tissue, mouse brain tissue, rat brain tissue, HeLa cells, C2C12 cells
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue
Positive IF/ICC detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11690-1-AP targets EXOC1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2303

Product name: Recombinant human EXOC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 139-488 aa of BC020650

Sequence: MPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH

Predict reactive species
Full Name exocyst complex component 1
Calculated Molecular Weight 894 aa, 102 kDa
Observed Molecular Weight 102 kDa
GenBank Accession NumberBC020650
Gene Symbol EXOC1
Gene ID (NCBI) 55763
RRIDAB_2231500
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NV70
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EXOC1 (exocyst complex component 1), also known as SEC3, is a component of the exocyst complex which is essential for the targeting of exocytic vesicles to specific docking sites on the plasma membrane. The exocyst complex is an octameric complex that tethers vesicles at the plasma membrane, regulates polarized exocytosis, and recruits membranes and proteins required for nanotube formation.Recently it has been reported that exocyst complex proteins are likely a key effector of Nef-mediated enhancement of nanotube formation, and possibly microvesicle secretion, which suggests a new paradigm of exocyst involvement in polarized targeting for intercellular transfer of viral proteins and viruses.

Protocols

Product Specific Protocols
IF protocol for EXOC1 antibody 11690-1-APDownload protocol
IHC protocol for EXOC1 antibody 11690-1-APDownload protocol
IP protocol for EXOC1 antibody 11690-1-APDownload protocol
WB protocol for EXOC1 antibody 11690-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-EXO1 antibody (Cat# 11690-1-AP) has 16 citations spanning journals including Nature, Nature Nanotechnology, Advanced Science, Journal of Cell Biology, eLife, PLoS Pathogens, Cell Cycle, and Molecular Biology of the Cell. Research fields covered include endosomal trafficking, mitochondrial transfer, lysosome secretion, ciliogenesis, ER calcium dynamics, bacterial pathogenesis, glucose uptake, HIV biology, hepatocellular carcinoma, macrophage signaling, placental biology, cytokinesis, spermatogenesis, and amyloid precursor protein trafficking.

SpeciesApplicationTitle
humanWB

Nature

A phosphoinositide conversion mechanism for exit from endosomes.

Authors - Katharina Ketel
  • KD Validated
humanWB,IF

Nat Nanotechnol

Intercellular nanotubes mediate mitochondrial trafficking between cancer and immune cells.

Authors - Tanmoy Saha
  • KD Validated
mouseIF

Adv Sci (Weinh)

An Engineered Hierarchical Hydrogel with Immune Responsiveness and Targeted Mitochondrial Transfer to Augmented Bone Regeneration

Authors - Wenjin Cai
mouseWB

J Cell Biol

The exocyst controls lysosome secretion and antigen extraction at the immune synapse of B cells.

Authors - Juan José Sáez
mouseWB,IF

Commun Biol

The exocyst complex and intracellular vesicles mediate soluble protein trafficking to the primary cilium

Authors - S M Niedziółka
ratWB

Am J Physiol Cell Physiol

The Exocyst Complex is Required for the Trafficking and Delivery of KCa3.1 to the Basolateral Membrane of Polarized Epithelia

Authors - Matthew J E Logue
Loading...
||
New chat

Able™

正在加载,请稍候...