• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EXOC1 Polyclonal antibody

EXOC1 Polyclonal Antibody for IF/ICC
Cat No. CL488-11690

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

SEC3P, SEC3L1, SEC3, Exocyst complex component Sec3, Exocyst complex component 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inC2C12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11690 targets EXOC1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2303

Product name: Recombinant human EXOC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 139-488 aa of BC020650

Sequence: MPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH

Predict reactive species
Full Name exocyst complex component 1
Calculated Molecular Weight 894 aa, 102 kDa
Observed Molecular Weight 102 kDa
GenBank Accession NumberBC020650
Gene Symbol EXOC1
Gene ID (NCBI) 55763
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NV70
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EXOC1 (exocyst complex component 1), also known as SEC3, is a component of the exocyst complex which is essential for the targeting of exocytic vesicles to specific docking sites on the plasma membrane. The exocyst complex is an octameric complex that tethers vesicles at the plasma membrane, regulates polarized exocytosis, and recruits membranes and proteins required for nanotube formation.Recently it has been reported that exocyst complex proteins are likely a key effector of Nef-mediated enhancement of nanotube formation, and possibly microvesicle secretion, which suggests a new paradigm of exocyst involvement in polarized targeting for intercellular transfer of viral proteins and viruses.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 EXOC1 antibody CL488-11690Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...