EXOC1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84007-5-RR (same clone as 84007-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84007-5-RR (EXOC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84007-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 84007-5-RR (same clone as 84007-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 84007-5-RR (EXOC1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84007-5-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 84007-5-RR (same clone as 84007-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using EXOC1 antibody (84007-5-RR, Clone: 241058D6 ) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84007-5-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 84007-5-RR (same clone as 84007-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using EXOC1 antibody (84007-5-RR, Clone: 241058D6 ) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84007-5-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 84007-5-RR (same clone as 84007-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using EXOC1 antibody (84007-5-RR, Clone: 241058D6 ) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84007-5-PBS in a different storage buffer formulation.

EXOC1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84007-5-PBS

Clone No.241058D6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

241058D6, BM 102, Exocyst complex component 1, Exocyst complex component Sec3, SEC3

---

Product Information

84007-5-PBS targets EXOC1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2303

  Product name: Recombinant human EXOC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 139-488 aa of BC020650

  Sequence: MPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH

• Full Name: exocyst complex component 1
• Calculated Molecular Weight: 894 aa, 102 kDa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC020650
• Gene Symbol: EXOC1
• Gene ID (NCBI): 55763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NV70
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EXOC1 (exocyst complex component 1), also known as SEC3, is a component of the exocyst complex which is essential for the targeting of exocytic vesicles to specific docking sites on the plasma membrane. The exocyst complex is an octameric complex that tethers vesicles at the plasma membrane, regulates polarized exocytosis, and recruits membranes and proteins required for nanotube formation.Recently it has been reported that exocyst complex proteins are likely a key effector of Nef-mediated enhancement of nanotube formation, and possibly microvesicle secretion, which suggests a new paradigm of exocyst involvement in polarized targeting for intercellular transfer of viral proteins and viruses.