Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11178-1-AP targets EXOSC10 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA, CUT&Tag applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1666 Product name: Recombinant human EXOSC10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 586-885 aa of BC039901 Sequence: VAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR Predict reactive species |
| Full Name | exosome component 10 |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC039901 |
| Gene Symbol | EXOSC10 |
| Gene ID (NCBI) | 5394 |
| RRID | AB_2293792 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01780 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear
ucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EXOSC10 antibody 11178-1-AP | Download protocol |
| IHC protocol for EXOSC10 antibody 11178-1-AP | Download protocol |
| IP protocol for EXOSC10 antibody 11178-1-AP | Download protocol |
| WB protocol for EXOSC10 antibody 11178-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody EXOSC2 (Cat# 11178-1-AP) has 12 citations published in journals including Cancer Research, Nature Communications, Molecular Cell, Cell Reports, Cell Death & Disease, RNA, Development, International Journal of Molecular Sciences, and Life Science Alliance. Research fields span cancer (bladder cancer, NSCLC, metastasis), HIV regulation, RNA exosome biology, neurodegeneration (C9orf72), forebrain development, and SARS-CoV-2 replication.
| Species | Application | Title |
|---|---|---|
Cancer Res NAT10 drives cisplatin chemoresistance by enhancing ac4C-associated DNA repair in bladder cancer | ||
Nat Commun TASOR epigenetic repressor cooperates with a CNOT1 RNA degradation pathway to repress HIV. | ||
Mol Cell RNA exonuclease REXO4 resolves m(6)A-marked R-loops and suppresses anti-tumor immunity. | ||
Cell Death Dis LncRNA EP300-AS1 interacts with PTBP1 to destabilize PRMT5 mRNA and suppresses NSCLC growth and metastasis | ||
Cell Rep Cytoplasmic DIS3 is an exosome-independent endoribonuclease with catalytic activity toward circular RNAs | ||
Reviews
What customers say
Both reviewers used the antibody for Western Blot and confirmed detection of EXOSC10 (~100 kDa). One user achieved clean results in HeLa cells at 1:1000 dilution with overnight incubation at 4°C, giving a 5-star rating. The other user tested it in mESCs at 1:2000 and observed the expected band but noted some non-specific bands at higher molecular weights, rating it 4 stars. Overall, the antibody performs well for EXOSC10 detection by WB, though some users may encounter background at higher dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (06-12-2024) | Did detect EXOSC10 by WB (1/1000 - overnight incubation at 4°C) in HeLa cells.
|
Tsimafei (Verified Customer) (12-17-2023) | Antibody detect Exosc10 (around 100 kDa on the image). However non-specific bands are observed in higher molecular weight area
 |
