Tested Applications
| Positive WB detected in | BxPC-3 cells, HeLa cells, mouse spleen tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human stomach cancer tissue, mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16731-1-AP targets EXOSC10 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10189 Product name: Recombinant human EXOSC10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 540-885 aa of BC073788 Sequence: IAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR Predict reactive species |
| Full Name | exosome component 10 |
| Calculated Molecular Weight | 885 aa, 101 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC073788 |
| Gene Symbol | EXOSC10 |
| Gene ID (NCBI) | 5394 |
| RRID | AB_2101730 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01780 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear/nucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EXOSC10 antibody 16731-1-AP | Download protocol |
| IHC protocol for EXOSC10 antibody 16731-1-AP | Download protocol |
| IP protocol for EXOSC10 antibody 16731-1-AP | Download protocol |
| WB protocol for EXOSC10 antibody 16731-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EXOSC10 Polyclonal antibody (Cat# 16731-1-AP) has 1 citation. It appears in PeerJ (2023), in a study identifying EXOSC10 as a novel hepatocellular carcinoma prognostic biomarker through bioinformatics analysis and experimental verification. The research field is oncology/cancer biomarker discovery, specifically liver cancer. The antibody was used for WB and IHC applications in human samples.
| Species | Application | Title |
|---|---|---|
PeerJ EXOSC10 is a novel hepatocellular carcinoma prognostic biomarker: a comprehensive bioinformatics analysis and experiment verification
|
Reviews
What customers say
One user reviewed this antibody for Western Blot on mESCs at a 1:2000 dilution. They rated it 4 out of 5 stars, noting that the antibody recognized the expected Exosc10 band but also detected some non-specific bands. Overall, the reviewer found it functional for its intended target while acknowledging minor background issues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tsimafei (Verified Customer) (12-17-2023) | Antibody recognise Exosc10 band and some other non-specific bands
 |
