CoraLite® Plus 488-conjugated EXOSC10 Polyclonal antibody

• 

  IF Staining of HeLa using CL488-16731

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 EXOSC10 antibody (CL488-16731) at dilution of 1:200, CL594-Phalloidin (red).

• 

  FC experiment of HeLa using CL488-16731

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug Coralite® Plus 488 Exosc10 Polyclonal Antibody (CL488-16731)(red), or 0.4 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

EXOSC10 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-16731

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

EC:3.1.13.-, Exosome complex component 10, P100 polymyositis-scleroderma overlap syndrome-associated autoantigen, PM/Scl-100, RRP6

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16731 targets EXOSC10 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10189

  Product name: Recombinant human EXOSC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 540-885 aa of BC073788

  Sequence: IAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR

• Full Name: exosome component 10
• Calculated Molecular Weight: 885 aa, 101 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC073788
• Gene Symbol: EXOSC10
• Gene ID (NCBI): 5394
• RRID: AB_3672660
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01780
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear/nucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.