• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EXOSC10 Polyclonal antibody

EXOSC10 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-16731

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Rrp6p, RRP6, PM/Scl-100, P100 polymyositis-scleroderma overlap syndrome-associated autoantigen, Exosome complex component 10

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16731 targets EXOSC10 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10189

Product name: Recombinant human EXOSC10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 540-885 aa of BC073788

Sequence: IAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR

Predict reactive species
Full Name exosome component 10
Calculated Molecular Weight 885 aa, 101 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC073788
Gene Symbol EXOSC10
Gene ID (NCBI) 5394
RRIDAB_3672660
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01780
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear/nucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 EXOSC10 antibody CL488-16731Download protocol
FC protocol for CL Plus 488 EXOSC10 antibody CL488-16731Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...