• Featured Product
  • KD/KO Validated

EZH2 Monoclonal antibody

EZH2 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 66476-1-Ig
Clone No.1F10A12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

1F10A12, EC:2.1.1.356, Enhancer of zeste homolog 2, ENX 1, ENX-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A549 cells, Jurkat cells, ROS1728 cells, NIH/3T3 cells, 4T1 cells, A431 cells, PC-3 cells, DU145 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66476-1-Ig targets EZH2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16789

Product name: Recombinant human EZH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-261 aa of BC010858

Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT

Predict reactive species
Full Name enhancer of zeste homolog 2 (Drosophila)
Calculated Molecular Weight 751 aa, 86 kDa
Observed Molecular Weight 90-102 kDa
GenBank Accession NumberBC010858
Gene Symbol EZH2
Gene ID (NCBI) 2146
RRIDAB_2881842
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15910
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)

Protocols

Product Specific Protocols
FC protocol for EZH2 antibody 66476-1-IgDownload protocol
WB protocol for EZH2 antibody 66476-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Death Dis

Long noncoding RNA MEG3 regulates LATS2 by promoting the ubiquitination of EZH2 and inhibits proliferation and invasion in gallbladder cancer.

Authors - Longyang Jin

Cancer Sci

EZH2 suppresses ferroptosis in hepatocellular carcinoma and reduces sorafenib sensitivity through epigenetic regulation of TFR2

Authors - Yongwei Lai
humanWB

Cancer Med

LncRNA SPRY4-IT1 facilitates cell proliferation and angiogenesis of glioma via the miR-101-3p/EZH2/VEGFA signaling axis

Authors - Ji Wang
mouseWB

Int Immunopharmacol

Celastrol attenuates diabetic nephropathy by upregulating SIRT1-mediated inhibition of EZH2related wnt/β-catenin signaling

Authors - Yuewen Tang
humanWB

Int Immunopharmacol

Characterization of PANoptosis-related genes with immunoregulatory features in osteoarthritis

Authors - Zhibin Lan
WB

Cell Signal

CBX2 and EZH2 cooperatively contribute to 5-Fu resistance in gastric cancer by suppressing ferroptosis via trimethylation of H3k27

Authors - Miaomiao Zeng
Loading...
||
New chat

Able

正在加载,请稍候...