EZH2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• EZH2 Monoclonal antibody (66476-1-Ig)

• Featured Product
• KD/KO Validated

EZH2 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 66476-1-Ig Copied!

Clone No. 1F10A12

Publications (18)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

1F10A12, EC:2.1.1.356, Enhancer of zeste homolog 2, ENX 1, ENX-1

• 

  WB analysis of HEK-293 using 66476-1-Ig

  WB result of EZH2 antibody (66476-1-Ig; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EZH2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66476-1-Ig

  Various cell lines were subjected to SDS PAGE followed by western blot with 66476-1-Ig (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66476-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66476-1-Ig (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66476-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66476-1-Ig (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of ROS1728 using 66476-1-Ig

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 66476-1-Ig (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66476-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66476-1-Ig (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 4T1 using 66476-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 66476-1-Ig (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66476-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66476-1-Ig (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 66476-1-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug Anti-Human EZH2 (66476-1-Ig, Clone:1F10A12) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (green), and 0.2 ug Mouse IgG1 Isotype Control (66360-1-Ig, Clone: T1F8D3F10) (black). Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EZH2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A549 cells, Jurkat cells, ROS1728 cells, NIH/3T3 cells, 4T1 cells, A431 cells, PC-3 cells, DU145 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66476-1-Ig targets EZH2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16789

  Product name: Recombinant human EZH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 158-261 aa of BC010858

  Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT

• Full Name: enhancer of zeste homolog 2 (Drosophila)
• Calculated Molecular Weight: 751 aa, 86 kDa
• Observed Molecular Weight: 90-102 kDa
• GenBank Accession Number: BC010858
• Gene Symbol: EZH2
• Gene ID (NCBI): 2146
• RRID: AB_2881842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15910
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)

Publications

What published studies show

The EZH2 antibody (Cat# 66476-1-Ig) has 18 total citations spanning 15 journals, including Nature Communications, Bioactive Materials, Cell Death & Disease, and International Immunopharmacology. Research fields encompass epigenetics and chromatin regulation, oncology (breast, gastric, colorectal, glioma, hepatocellular, osteosarcoma, and lymphoma cancers), ferroptosis, diabetic complications, spinal cord injury, and endometriosis. Applications include WB, IHC, and IF across human, mouse, and rat species.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Bioact Mater; Engineered mesenchymal stem cell-derived small extracellular vesicles for diabetic retinopathy therapy through HIF-1α/EZH2/PGC-1α pathway; Authors - Fengtian Sun
mouse	WB	Nat Commun; Improving erectile function in diabetic male mice by rescuing depalmitoylated FBP1 to reduce cavernosal lactate.; Authors - Ming Xiao
		Nat Commun; Epigenomic modifications define chromatin states to regulate cell-free DNA fragmentomics.; Authors - Fanglei Gong
human	WB	Cell Death Dis; Long noncoding RNA MEG3 regulates LATS2 by promoting the ubiquitination of EZH2 and inhibits proliferation and invasion in gallbladder cancer.; Authors - Longyang Jin
human	WB	Cell Death Dis; BMSC-derived extracellular vesicles enhance osteosarcoma proliferation and metastasis via the circRNA-0010220/β-catenin pathway.; Authors - Runsang Pan
human	WB	Cell Commun Signal; VprBP drives prostate tumorigenesis by its kinase activity targeting histone H2A.; Authors - Sungmin Kim