• Featured Product
  • KD/KO Validated

EZH2 Monoclonal antibody, PBS Only

EZH2 Monoclonal Antibody for WB, FC (Intra), Indirect ELISA
Cat No. 66476-1-PBS
Clone No.1F10A12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Indirect ELISA

1F10A12, EC:2.1.1.356, Enhancer of zeste homolog 2, ENX 1, ENX-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66476-1-PBS targets EZH2 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16789

Product name: Recombinant human EZH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-261 aa of BC010858

Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT

Predict reactive species
Full Name enhancer of zeste homolog 2 (Drosophila)
Calculated Molecular Weight 751 aa, 86 kDa
Observed Molecular Weight 90-102 kDa
GenBank Accession NumberBC010858
Gene Symbol EZH2
Gene ID (NCBI) 2146
RRIDAB_2881842
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15910
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)

Loading...
||
New chat Able
正在加载,请稍候...