• Featured Product
  • KD/KO Validated

FABP5 Polyclonal antibody

FABP5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 12348-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

EFABP, Epidermal-type fatty acid-binding protein, Fatty acid binding protein 5, Fatty acid-binding protein 5, Fatty acid-binding protein, epidermal

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, Hepa1-6 cells, HepG2 cells, mouse skin tissue, HeLa cells, A431 cells
Positive IP detected inA375 cells
Positive IHC detected inmouse skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12348-1-AP targets FABP5 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3005

Product name: Recombinant human FABP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-135 aa of BC019385

Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Predict reactive species
Full Name fatty acid binding protein 5 (psoriasis-associated)
Calculated Molecular Weight 135 aa, 15 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC019385
Gene Symbol FABP5
Gene ID (NCBI) 2171
RRIDAB_2100341
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01469
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232)

Protocols

Product Specific Protocols
FC protocol for FABP5 antibody 12348-1-APDownload protocol
IF protocol for FABP5 antibody 12348-1-APDownload protocol
IHC protocol for FABP5 antibody 12348-1-APDownload protocol
IP protocol for FABP5 antibody 12348-1-APDownload protocol
WB protocol for FABP5 antibody 12348-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseCoIP

Nat Metab

Intestinal TM6SF2 protects against metabolic dysfunction-associated steatohepatitis through the gut-liver axis

Authors - Xiang Zhang
mouse,humanWB,CoIP

Nat Commun

Oxidative stress-induced FABP5 S-glutathionylation protects against acute lung injury by suppressing inflammation in macrophages.

Authors - Yuxian Guo
mouseWB

Biomaterials

MMP-12 siRNA improves the homeostasis of the small intestine and metabolic dysfunction in high-fat diet feeding-induced obese mice.

Authors - Mingming Song
humanIF

Mol Ther

Single-Cell Transcriptome Analysis Reveals Intratumoral Heterogeneity in ccRCC, which Results in Different Clinical Outcomes.

Authors - Junyi Hu
humanWB

EMBO Rep

Lin28 enhances de novo fatty acid synthesis to promote cancer progression via SREBP-1.

Authors - Yang Zhang
ratWB

Phytomedicine

Podophyllotoxin via SIRT1/PPAR /NF-κB axis induced cardiac injury in rats based on the toxicological evidence chain (TEC) concept

Authors - Tao Jiang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vanessa (Verified Customer) (11-12-2025)

I used the FAB antibody for immunolabeling 100 µm frozen mouse brain sections collected at postnatal day 12 (P12) and postnatal day 30 (P30). The antibody performed well overall, showing strong and specific labeling of the expected structures in both age groups. Signal penetration through the thick frozen sections was good, and labeling was consistent across samples. There was a mild level of background staining, particularly in some cortical regions, but this did not interfere with interpretation of the specific signal. Adjusting blocking conditions and antibody dilution helped reduce the background. In general, the FAB antibody is reliable for use in thick frozen brain sections. It produces clear, reproducible staining with manageable background, making it suitable for developmental and comparative studies. Pros: Good penetration and signal in thick (100 µm) frozen sections Strong, consistent labelling at P12 and P30 Reproducible results Cons: Slight nonspecific background in some areas

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: brain
FH

Kenzo (Verified Customer) (01-09-2023)

Robust immunoreactivity detected.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse nerve
Loading...
||
New chat

Able

正在加载,请稍候...