FABP5 Polyclonal antibody

• 

  WB analysis of A375 using 12348-1-AP

  WB result of FABP5 antibody (12348-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FABP5 transfected A375 cells.

• 

  WB analysis using 12348-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12348-1-AP (FABP5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Hepa1-6 using 12348-1-AP

  WB result of FABP5 antibody (12348-1-AP; 1:800; room temperature for 1.5 hours) with wild-type and FABP5 knockout Hepa1-6 cells.

• 

  WB analysis of mouse skin using 12348-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 12348-1-AP (FABP5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A375 using 12348-1-AP

  IP result of anti-FABP5 (IP:12348-1-AP, 4ug; Detection:12348-1-AP 1:4000) with A375 cells lysate 1520 ug.

• 

  IHC staining of mouse skin using 12348-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 12348-1-AP (FABP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 12348-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 12348-1-AP (FABP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 12348-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FABP5 antibody (12348-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  FC experiment of HeLa using 12348-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug FABP5 Polyclonal antibody (12348-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

FABP5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 12348-1-AP

Publications(48)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

EFABP, Epidermal-type fatty acid-binding protein, Fatty acid binding protein 5, Fatty acid-binding protein 5, Fatty acid-binding protein, epidermal

---

Tested Applications

• Positive WB detected in: A375 cells, Hepa1-6 cells, HepG2 cells, mouse skin tissue, HeLa cells, A431 cells
• Positive IP detected in: A375 cells
• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 39 publications below
• IHC: See 12 publications below
• IF: See 11 publications below
• CoIP: See 3 publications below

Product Information

12348-1-AP targets FABP5 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3005

  Product name: Recombinant human FABP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC019385

  Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

• Full Name: fatty acid binding protein 5 (psoriasis-associated)
• Calculated Molecular Weight: 135 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC019385
• Gene Symbol: FABP5
• Gene ID (NCBI): 2171
• RRID: AB_2100341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01469
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	CoIP	Nat Metab; Intestinal TM6SF2 protects against metabolic dysfunction-associated steatohepatitis through the gut-liver axis; Authors - Xiang Zhang
mouse,human	WB,CoIP	Nat Commun; Oxidative stress-induced FABP5 S-glutathionylation protects against acute lung injury by suppressing inflammation in macrophages.; Authors - Yuxian Guo
mouse	WB	Biomaterials; MMP-12 siRNA improves the homeostasis of the small intestine and metabolic dysfunction in high-fat diet feeding-induced obese mice.; Authors - Mingming Song
human	IF	Mol Ther; Single-Cell Transcriptome Analysis Reveals Intratumoral Heterogeneity in ccRCC, which Results in Different Clinical Outcomes.; Authors - Junyi Hu
human	WB	EMBO Rep; Lin28 enhances de novo fatty acid synthesis to promote cancer progression via SREBP-1.; Authors - Yang Zhang
rat	WB	Phytomedicine; Podophyllotoxin via SIRT1/PPAR /NF-κB axis induced cardiac injury in rats based on the toxicological evidence chain (TEC) concept; Authors - Tao Jiang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Vanessa (Verified Customer) (11-12-2025)

I used the FAB antibody for immunolabeling 100 µm frozen mouse brain sections collected at postnatal day 12 (P12) and postnatal day 30 (P30). The antibody performed well overall, showing strong and specific labeling of the expected structures in both age groups. Signal penetration through the thick frozen sections was good, and labeling was consistent across samples. There was a mild level of background staining, particularly in some cortical regions, but this did not interfere with interpretation of the specific signal. Adjusting blocking conditions and antibody dilution helped reduce the background. In general, the FAB antibody is reliable for use in thick frozen brain sections. It produces clear, reproducible staining with manageable background, making it suitable for developmental and comparative studies. Pros: Good penetration and signal in thick (100 µm) frozen sections Strong, consistent labelling at P12 and P30 Reproducible results Cons: Slight nonspecific background in some areas

• Applications: Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: brain

FH

Kenzo (Verified Customer) (01-09-2023)

Robust immunoreactivity detected.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse nerve