Tested Applications
| Positive WB detected in | A431 cells, C6 cells, HEK-293 cells, HUVEC cells, HeLa cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | Hepatocellular carcinoma tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12636-1-AP targets FAK in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3331 Product name: Recombinant human FAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR Predict reactive species |
| Full Name | PTK2 protein tyrosine kinase 2 |
| Calculated Molecular Weight | 1052 aa, 119 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC028733 |
| Gene Symbol | FAK |
| Gene ID (NCBI) | 5747 |
| RRID | AB_2173668 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05397 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FAK antibody 12636-1-AP | Download protocol |
| IHC protocol for FAK antibody 12636-1-AP | Download protocol |
| IP protocol for FAK antibody 12636-1-AP | Download protocol |
| WB protocol for FAK antibody 12636-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FAK Polyclonal antibody (Cat# 12636-1-AP) has accumulated 161 citations in journals including Nature Communications, Nature Cell Biology, Cell Metabolism, Cancer Research, Oncogene, Biomaterials, Acta Biomaterialia, Science Advances, and EMBO Journal. Associated research fields encompass oncology (colorectal, breast, lung, gastric, liver, and ovarian cancers), wound healing, fibrosis, cardiovascular disease, mechanobiology, cell migration, angiogenesis, diabetes, immunology, biomaterials, and drug discovery.
| Species | Application | Title |
|---|---|---|
Mol Cancer EIF4A3/circPTGR1/miR-4725-5p positive- feedback loop promotes colorectal cancer progression via FAK/AKT signaling pathway. | ||
Cell Metab Gut microbial co-metabolite 2-methylbutyrylcarnitine exacerbates thrombosis via binding to and activating integrin α2β1 | ||
Gut CD48 is a novel immune checkpoint on tumour-associated macrophages in hepatocellular carcinoma | ||
Bioact Mater Mechanically sensitized hydrogel microspheres trigger membrane receptor switch for cartilage repair. | ||
Nat Cell Biol Gain of miR-151 on chromosome 8q24.3 facilitates tumour cell migration and spreading through downregulating RhoGDIA. | ||
Cancer Res Retinoic acid-related orphan receptor C regulates proliferation, glycolysis, and chemoresistance via the PD-L1/ITGB6/STAT3 signaling axis in bladder cancer. |
Reviews
What customers say
The product received a 4-star rating for use in immunohistochemistry on human skin tissue at a 1/50 dilution. The reviewer described it as "good for immunohistochemistry," indicating satisfactory performance in this application. Overall, the limited feedback suggests the antibody works well for IHC, though no additional details on specificity, background, or staining quality were provided.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nathalie (Verified Customer) (07-12-2022) | Good for ImmunoHistochemistry
|
