FAM20A Polyclonal antibody

• 

  WB analysis of mouse lung using 25258-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 25258-1-AP (FAM20A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 25258-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25258-1-AP (FAM20A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 25258-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25258-1-AP (FAM20A antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary using 25258-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 25258-1-AP (FAM20A Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 25258-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 25258-1-AP (FAM20A Antibody) at dilution of 1:50 (under 40x lens).

FAM20A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25258-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

UNQ9388/PRO34279, Pseudokinase FAM20A, Protein FAM20A, FP2747

---

Tested Applications

• Positive WB detected in: mouse lung tissue
• Positive IHC detected in: human colon cancer tissue, human ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

25258-1-AP targets FAM20A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19494

  Product name: Recombinant human FAM20A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 424-541 aa of BC136686

  Sequence: GFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDGPVEQSAPDSGQANLTS

• Full Name: family with sequence similarity 20, member A
• Calculated Molecular Weight: 541 aa, 61 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC136686
• Gene Symbol: FAM20A
• Gene ID (NCBI): 54757
• RRID: AB_2879991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MK3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Front Immunol; FAM20A: a potential diagnostic biomarker for lung squamous cell carcinoma; Authors - Yalin Zhang