Tested Applications
Positive WB detected in | HeLa cells, SGC-7901 cells, hTERT-RPE1 cells |
Positive IHC detected in | human skin tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 48 publications below |
WB | See 128 publications below |
IHC | See 48 publications below |
IF | See 99 publications below |
CoIP | See 6 publications below |
Product Information
15939-1-AP targets Piezo1 (extracellular domain) in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse, rat, pig, canine, zebrafish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7791 Product name: Recombinant human FAM38A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 67-373 aa of BC008073 Sequence: SVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKHHGAVRVHRAGHRQVRARILQRDLALHYVRGAAVRGPHPQALPGHLPGAGDSGAGAGGGVVCQAHLPLPLTGDHDQVDS Predict reactive species |
Full Name | family with sequence similarity 38, member A |
Calculated Molecular Weight | 286 kDa |
Observed Molecular Weight | 233-286 kDa |
GenBank Accession Number | BC008073 |
Gene Symbol | Piezo1/FAM38A |
Gene ID (NCBI) | 9780 |
RRID | AB_2231460 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92508 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells that influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as Piezo1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Piezo1 also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in the gene encoding Piezo1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1. (PMID: 20016066, 28416610)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Piezo1 (extracellular domain) antibody 15939-1-AP | Download protocol |
IHC protocol for Piezo1 (extracellular domain) antibody 15939-1-AP | Download protocol |
IF protocol for Piezo1 (extracellular domain) antibody 15939-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nature Skin cells undergo asynthetic fission to expand body surfaces in zebrafish.
| ||
Nature Crowding induces live cell extrusion to maintain homeostatic cell numbers in epithelia.
| ||
Nature Mechanical stretch triggers rapid epithelial cell division through Piezo1.
| ||
Blood Mechanosensation by endothelial PIEZO1 is required for leukocyte diapedesis.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hyun (Verified Customer) (07-23-2025) | This antibody works well for western blot.
|
FH Jason (Verified Customer) (02-11-2025) | The antibody works well. However, due to the large protein size, obtaining sharp and clean Western blot bands is challenging for me. In fluorescence staining, the knockout cells were stained similarly to the control cells, suggesting non-specific staining in IF.
![]() |
FH Hyojin (Verified Customer) (01-19-2024) | I like the quality of antibody. Thank you for generating.
|
FH Sammy (Verified Customer) (12-04-2023) | Ab detects a band at the correct size but the signal is weak. This works only when detected via HRP/Chemi. NIR-conjugated antibodies do not detect this band.
![]() |
FH Xiaonan (Verified Customer) (02-01-2023) | We did not see the band for Piezol.
![]() |
FH LUNFENG (Verified Customer) (01-27-2020) | GOOD
|
FH Jie (Verified Customer) (01-23-2020) | Works with one band. Due to the large protein size, band does not always show sharp image.
|
FH Canzhao (Verified Customer) (01-17-2020) | It worked in western blot and showed nice band.
|
FH Zeinab (Verified Customer) (09-27-2019) | Worked great, Clean and Specific
|